BLASTX nr result
ID: Cinnamomum25_contig00025155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00025155 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010264040.1| PREDICTED: sterol 3-beta-glucosyltransferase... 58 3e-06 ref|XP_010264039.1| PREDICTED: sterol 3-beta-glucosyltransferase... 58 3e-06 >ref|XP_010264040.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80A2-like isoform X2 [Nelumbo nucifera] Length = 508 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 320 TGAVKAFFKHLPPRNPPTQPSPVPTGFFEPCFSS 219 +GAV+AFFKHLP + P QPSPVP+GFFE CF S Sbjct: 467 SGAVRAFFKHLPSKKPEPQPSPVPSGFFEHCFGS 500 >ref|XP_010264039.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80A2-like isoform X1 [Nelumbo nucifera] Length = 615 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 320 TGAVKAFFKHLPPRNPPTQPSPVPTGFFEPCFSS 219 +GAV+AFFKHLP + P QPSPVP+GFFE CF S Sbjct: 574 SGAVRAFFKHLPSKKPEPQPSPVPSGFFEHCFGS 607