BLASTX nr result
ID: Cinnamomum25_contig00025102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00025102 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009781042.1| PREDICTED: dentin sialophosphoprotein [Nicot... 80 5e-13 ref|XP_010248267.1| PREDICTED: midasin-like [Nelumbo nucifera] 79 1e-12 ref|XP_009605699.1| PREDICTED: myb-like protein X [Nicotiana tom... 79 2e-12 ref|XP_004230671.1| PREDICTED: myb-like protein X [Solanum lycop... 78 2e-12 ref|XP_006422728.1| hypothetical protein CICLE_v10028128mg [Citr... 77 3e-12 ref|XP_006486866.1| PREDICTED: myb-like protein X-like isoform X... 77 4e-12 ref|XP_006367100.1| PREDICTED: myb-like protein X-like isoform X... 77 4e-12 ref|XP_006367098.1| PREDICTED: myb-like protein X-like isoform X... 77 4e-12 ref|XP_012828334.1| PREDICTED: suppressor of Mek1 [Erythranthe g... 75 1e-11 gb|EYU18351.1| hypothetical protein MIMGU_mgv1a007721mg [Erythra... 75 1e-11 ref|XP_006852769.1| PREDICTED: cyclic nucleotide-gated cation ch... 75 2e-11 ref|XP_010095631.1| hypothetical protein L484_003732 [Morus nota... 74 4e-11 gb|KHG13179.1| hypothetical protein F383_01772 [Gossypium arboreum] 73 6e-11 ref|XP_009335368.1| PREDICTED: dentin sialophosphoprotein isofor... 73 6e-11 ref|XP_009335366.1| PREDICTED: myb-like protein X isoform X1 [Py... 73 6e-11 ref|XP_002522077.1| Pinin, putative [Ricinus communis] gi|223538... 73 6e-11 ref|XP_010104533.1| hypothetical protein L484_025507 [Morus nota... 73 8e-11 ref|XP_012480587.1| PREDICTED: myb-like protein X [Gossypium rai... 73 8e-11 ref|XP_008372948.1| PREDICTED: high mobility group nucleosome-bi... 73 8e-11 emb|CBI25108.3| unnamed protein product [Vitis vinifera] 72 1e-10 >ref|XP_009781042.1| PREDICTED: dentin sialophosphoprotein [Nicotiana sylvestris] Length = 486 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M++Q SRNHRSKG+K+ HVLQ+CLLLA+C WL+YQVKHSHDKK+ Sbjct: 1 MYKQSPSRNHRSKGIKLKHVLQICLLLAVCFWLIYQVKHSHDKKK 45 >ref|XP_010248267.1| PREDICTED: midasin-like [Nelumbo nucifera] Length = 497 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 MFRQ SRN RSKG KV H LQ+CLLL +CIWLLYQVKHSHDKK+ Sbjct: 1 MFRQSPSRNQRSKGFKVKHALQICLLLGVCIWLLYQVKHSHDKKK 45 >ref|XP_009605699.1| PREDICTED: myb-like protein X [Nicotiana tomentosiformis] gi|697103800|ref|XP_009605700.1| PREDICTED: myb-like protein X [Nicotiana tomentosiformis] Length = 488 Score = 78.6 bits (192), Expect = 2e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M++Q RNHRSKG+K+ HVLQ+CLLLA+C WL+YQVKHSHDKK+ Sbjct: 1 MYKQSPGRNHRSKGIKLKHVLQICLLLAVCFWLIYQVKHSHDKKK 45 >ref|XP_004230671.1| PREDICTED: myb-like protein X [Solanum lycopersicum] gi|723664875|ref|XP_010315168.1| PREDICTED: myb-like protein X [Solanum lycopersicum] Length = 524 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M++Q SRNHRSKG+KV +VLQ+CLLLA+C WL+YQVKHSHDKK+ Sbjct: 1 MYKQSPSRNHRSKGVKVKNVLQICLLLAVCFWLIYQVKHSHDKKK 45 >ref|XP_006422728.1| hypothetical protein CICLE_v10028128mg [Citrus clementina] gi|557524662|gb|ESR35968.1| hypothetical protein CICLE_v10028128mg [Citrus clementina] Length = 552 Score = 77.4 bits (189), Expect = 3e-12 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKK 4 M ++ SRNHRSKG+KV HVLQ+CLLL +C WL+YQVKHSHDKK Sbjct: 1 MIKRAPSRNHRSKGIKVKHVLQICLLLGVCFWLIYQVKHSHDKK 44 >ref|XP_006486866.1| PREDICTED: myb-like protein X-like isoform X1 [Citrus sinensis] gi|568867067|ref|XP_006486867.1| PREDICTED: myb-like protein X-like isoform X2 [Citrus sinensis] Length = 577 Score = 77.0 bits (188), Expect = 4e-12 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKK 4 M ++ SRNHRSKG+KV HVLQ+CLLL +C WL+YQVKHSHDKK Sbjct: 1 MIKRALSRNHRSKGIKVKHVLQICLLLGVCFWLIYQVKHSHDKK 44 >ref|XP_006367100.1| PREDICTED: myb-like protein X-like isoform X3 [Solanum tuberosum] Length = 708 Score = 77.0 bits (188), Expect = 4e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M++Q SRNHRSKG+KV +VLQ+CLL+A+C WL+YQVKHSHDKK+ Sbjct: 1 MYKQSPSRNHRSKGVKVKNVLQICLLVAVCFWLIYQVKHSHDKKK 45 >ref|XP_006367098.1| PREDICTED: myb-like protein X-like isoform X1 [Solanum tuberosum] gi|565403298|ref|XP_006367099.1| PREDICTED: myb-like protein X-like isoform X2 [Solanum tuberosum] Length = 737 Score = 77.0 bits (188), Expect = 4e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M++Q SRNHRSKG+KV +VLQ+CLL+A+C WL+YQVKHSHDKK+ Sbjct: 1 MYKQSPSRNHRSKGVKVKNVLQICLLVAVCFWLIYQVKHSHDKKK 45 >ref|XP_012828334.1| PREDICTED: suppressor of Mek1 [Erythranthe guttatus] Length = 410 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M+RQ SRN RSKG++V HV+Q+C LLA+C WL+YQVKHSHDKK+ Sbjct: 1 MYRQSPSRNQRSKGIRVKHVIQICALLAVCFWLIYQVKHSHDKKK 45 >gb|EYU18351.1| hypothetical protein MIMGU_mgv1a007721mg [Erythranthe guttata] Length = 397 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M+RQ SRN RSKG++V HV+Q+C LLA+C WL+YQVKHSHDKK+ Sbjct: 1 MYRQSPSRNQRSKGIRVKHVIQICALLAVCFWLIYQVKHSHDKKK 45 >ref|XP_006852769.1| PREDICTED: cyclic nucleotide-gated cation channel beta-1 [Amborella trichopoda] gi|548856383|gb|ERN14236.1| hypothetical protein AMTR_s00033p00139500 [Amborella trichopoda] Length = 501 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 MFRQ S RNHRSKG K+ H LQ+ LL+A+CIWLLYQVKHSH K++ Sbjct: 1 MFRQTSGRNHRSKGFKIRHALQIGLLVAVCIWLLYQVKHSHGKRK 45 >ref|XP_010095631.1| hypothetical protein L484_003732 [Morus notabilis] gi|587872293|gb|EXB61538.1| hypothetical protein L484_003732 [Morus notabilis] Length = 534 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M +++ SRN RSKG++V HVLQ+CLLL +C WL+YQVKHSHDKK+ Sbjct: 1 MLKRLPSRNQRSKGIRVKHVLQICLLLGVCFWLIYQVKHSHDKKK 45 >gb|KHG13179.1| hypothetical protein F383_01772 [Gossypium arboreum] Length = 543 Score = 73.2 bits (178), Expect = 6e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 MF++ SSRN RSKG+++ HVLQ+CLLL +C WL+YQVK SHDK++ Sbjct: 1 MFKKTSSRNQRSKGIRIKHVLQICLLLGVCFWLIYQVKRSHDKRK 45 >ref|XP_009335368.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Pyrus x bretschneideri] Length = 547 Score = 73.2 bits (178), Expect = 6e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKK 4 M ++ SRN R+KG+KV HVLQ+CLLL +C WL+YQVKHSHDKK Sbjct: 1 MIKRAPSRNQRTKGIKVRHVLQICLLLGVCFWLIYQVKHSHDKK 44 >ref|XP_009335366.1| PREDICTED: myb-like protein X isoform X1 [Pyrus x bretschneideri] gi|694414282|ref|XP_009335367.1| PREDICTED: myb-like protein X isoform X1 [Pyrus x bretschneideri] Length = 559 Score = 73.2 bits (178), Expect = 6e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKK 4 M ++ SRN R+KG+KV HVLQ+CLLL +C WL+YQVKHSHDKK Sbjct: 1 MIKRAPSRNQRTKGIKVRHVLQICLLLGVCFWLIYQVKHSHDKK 44 >ref|XP_002522077.1| Pinin, putative [Ricinus communis] gi|223538676|gb|EEF40277.1| Pinin, putative [Ricinus communis] Length = 584 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 M ++ SRN RSKG KV HVLQ+CLLL +C WL+YQVKHSHDKK+ Sbjct: 1 MIKRTPSRNTRSKGFKVKHVLQICLLLGVCFWLIYQVKHSHDKKK 45 >ref|XP_010104533.1| hypothetical protein L484_025507 [Morus notabilis] gi|587913317|gb|EXC01134.1| hypothetical protein L484_025507 [Morus notabilis] Length = 375 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKK 4 M +Q SRN R KG KV HVLQ+C+LLAICIWLLYQVKHS+DKK Sbjct: 1 MLKQSPSRNQRPKGFKVKHVLQICVLLAICIWLLYQVKHSNDKK 44 >ref|XP_012480587.1| PREDICTED: myb-like protein X [Gossypium raimondii] gi|823161437|ref|XP_012480588.1| PREDICTED: myb-like protein X [Gossypium raimondii] gi|763765557|gb|KJB32811.1| hypothetical protein B456_005G262800 [Gossypium raimondii] gi|763765558|gb|KJB32812.1| hypothetical protein B456_005G262800 [Gossypium raimondii] Length = 536 Score = 72.8 bits (177), Expect = 8e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 MF++ SSRN RSKG+++ HVLQ+CLLL +C WL+YQVK SHDK++ Sbjct: 1 MFKKTSSRNQRSKGIRIKHVLQICLLLGVCFWLVYQVKRSHDKRK 45 >ref|XP_008372948.1| PREDICTED: high mobility group nucleosome-binding domain-containing protein 5 [Malus domestica] gi|657962694|ref|XP_008372949.1| PREDICTED: high mobility group nucleosome-binding domain-containing protein 5 [Malus domestica] gi|657962696|ref|XP_008372950.1| PREDICTED: high mobility group nucleosome-binding domain-containing protein 5 [Malus domestica] Length = 551 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 135 MFRQVSSRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKK 4 M ++ SRN R+KG++V HVLQ+CLLL +C WLLYQVKHSHDKK Sbjct: 1 MIKRTPSRNQRTKGIRVKHVLQICLLLGVCFWLLYQVKHSHDKK 44 >emb|CBI25108.3| unnamed protein product [Vitis vinifera] Length = 116 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 117 SRNHRSKGLKVMHVLQMCLLLAICIWLLYQVKHSHDKKE 1 SRN RSKG KV H+LQ+CLLLA+C WL+YQVKHSHDKK+ Sbjct: 6 SRNQRSKGFKVKHILQICLLLAVCFWLIYQVKHSHDKKK 44