BLASTX nr result
ID: Cinnamomum25_contig00023650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00023650 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826428.1| PREDICTED: nuclear pore complex protein NUP1... 63 9e-08 >ref|XP_006826428.1| PREDICTED: nuclear pore complex protein NUP1 [Amborella trichopoda] gi|548830742|gb|ERM93665.1| hypothetical protein AMTR_s00004p00164270 [Amborella trichopoda] Length = 1329 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 119 NPSTDGRSSWLSKLVDPASRIISGSAARLFSSVFRKRL 6 NPS +GR+ WLSKLVDPAS+II+ AA+LFSSVFRKRL Sbjct: 39 NPSDEGRNGWLSKLVDPASKIIANGAAKLFSSVFRKRL 76