BLASTX nr result
ID: Cinnamomum25_contig00023371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00023371 (345 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09755.1| hypothetical protein B456_001G162200 [Gossypium r... 77 4e-12 gb|KJB82786.1| hypothetical protein B456_013G212900 [Gossypium r... 73 8e-11 >gb|KJB09755.1| hypothetical protein B456_001G162200 [Gossypium raimondii] Length = 592 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/51 (74%), Positives = 39/51 (76%) Frame = -2 Query: 155 QNCRIQAYGAVISSQTGQVEFQSQLLFIPPEYLLSHNLHWTFDLSNLVAKC 3 Q CRI AYG VISSQT QVEFQS F PEYLL +LHWTFDLSNLVA C Sbjct: 72 QFCRILAYGDVISSQTCQVEFQSYFPFFSPEYLLPQSLHWTFDLSNLVANC 122 >gb|KJB82786.1| hypothetical protein B456_013G212900 [Gossypium raimondii] Length = 323 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -2 Query: 155 QNCRIQAYGAVISSQTGQVEFQSQLLFIPPEYLLSHNLHWTFDLSNLVAKC 3 QN I AYG VIS+QT QVEFQS F PEYLL +LHWTFDLSNLVA C Sbjct: 65 QNPLILAYGGVISNQTCQVEFQSYFPFFSPEYLLPQSLHWTFDLSNLVANC 115