BLASTX nr result
ID: Cinnamomum25_contig00023358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00023358 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicot... 72 2e-10 ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomen... 71 3e-10 ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabac... 68 3e-09 gb|EYU38448.1| hypothetical protein MIMGU_mgv1a018999mg, partial... 60 6e-07 >ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453920|gb|AEO95578.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454031|gb|AEO95688.1| hypothetical protein [synthetic construct] Length = 99 Score = 71.6 bits (174), Expect = 2e-10 Identities = 39/62 (62%), Positives = 47/62 (75%), Gaps = 5/62 (8%) Frame = +2 Query: 41 HESDKEG*SPIEF*-----DPAHPITIGMIPIRNMSRKRKYLLNRSQEYQLQYL*AKEES 205 ++++KEG +P+EF D H IT GM PIRNM+ KRKYLLNR QEYQLQYL +KEES Sbjct: 39 NQTNKEG-NPVEFLRFHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEES 97 Query: 206 FQ 211 FQ Sbjct: 98 FQ 99 >ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomentosiformis] gi|80750940|dbj|BAE48016.1| hypothetical protein [Nicotiana tomentosiformis] Length = 99 Score = 70.9 bits (172), Expect = 3e-10 Identities = 39/62 (62%), Positives = 46/62 (74%), Gaps = 5/62 (8%) Frame = +2 Query: 41 HESDKEG*SPIEF*-----DPAHPITIGMIPIRNMSRKRKYLLNRSQEYQLQYL*AKEES 205 +++ KEG +P+EF D H IT GM PIRNM+ KRKYLLNR QEYQLQYL +KEES Sbjct: 39 NQTKKEG-NPVEFLRFHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEES 97 Query: 206 FQ 211 FQ Sbjct: 98 FQ 99 >ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabacum] gi|78102550|ref|YP_358691.1| hypothetical protein NisyCp046 [Nicotiana sylvestris] gi|11846|emb|CAA77366.1| hypothetical protein [Nicotiana tabacum] gi|77799577|dbj|BAE46666.1| hypothetical protein [Nicotiana sylvestris] gi|225214|prf||1211235AV ORF 99A Length = 99 Score = 67.8 bits (164), Expect = 3e-09 Identities = 39/62 (62%), Positives = 46/62 (74%), Gaps = 5/62 (8%) Frame = +2 Query: 41 HESDKEG*SPIEF*-----DPAHPITIGMIPIRNMSRKRKYLLNRSQEYQLQYL*AKEES 205 ++++KEG S +EF D H IT GM PIRNM+ KRKYLLNR QEYQLQYL +KEES Sbjct: 39 NQTNKEGNS-VEFLRFHVDDSIHSITRGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEES 97 Query: 206 FQ 211 FQ Sbjct: 98 FQ 99 >gb|EYU38448.1| hypothetical protein MIMGU_mgv1a018999mg, partial [Erythranthe guttata] Length = 82 Score = 60.1 bits (144), Expect = 6e-07 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 8/79 (10%) Frame = +2 Query: 41 HESDKEG*SPIEF*-----DPAHPIT---IGMIPIRNMSRKRKYLLNRSQEYQLQYL*AK 196 ++++KEG P+EF + HPIT I M IRNM+ KRKYL+N+SQEYQ YL +K Sbjct: 8 NQTNKEG-HPVEFLHFHVYNSIHPITNYYIRMNLIRNMNHKRKYLVNQSQEYQQLYLLSK 66 Query: 197 EESFQ*YRPFTHFPPHFIK 253 EESF RPF +FIK Sbjct: 67 EESF---RPFVPLHSNFIK 82