BLASTX nr result
ID: Cinnamomum25_contig00022876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00022876 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010911449.1| PREDICTED: cellular nucleic acid-binding pro... 59 1e-06 ref|XP_012081843.1| PREDICTED: uncharacterized protein LOC105641... 59 1e-06 >ref|XP_010911449.1| PREDICTED: cellular nucleic acid-binding protein-like, partial [Elaeis guineensis] Length = 155 Score = 59.3 bits (142), Expect = 1e-06 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = +1 Query: 1 HNCKKYGHYANQCKSKICRYCKATGHVIEECRKKARN 111 ++C+KYGH A CK K CRYC+ GH++ ECR++A+N Sbjct: 73 YSCQKYGHIARDCKEKFCRYCRKGGHILTECRRRAQN 109 >ref|XP_012081843.1| PREDICTED: uncharacterized protein LOC105641843 [Jatropha curcas] Length = 330 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = +1 Query: 1 HNCKKYGHYANQCKSKICRYCKATGHVIEECRKKARNSASR 123 ++CK +GH A+QC K C YCK GH+I ECRK+ +N S+ Sbjct: 233 YSCKGFGHIASQCSQKFCNYCKTKGHIISECRKRPQNRTSQ 273