BLASTX nr result
ID: Cinnamomum25_contig00022836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00022836 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012090628.1| PREDICTED: mitochondrial import inner membra... 90 5e-16 ref|XP_002511123.1| translocase of inner mitochondrial membrane,... 89 9e-16 ref|XP_010250594.1| PREDICTED: mitochondrial import inner membra... 89 1e-15 emb|CDP14990.1| unnamed protein product [Coffea canephora] 88 3e-15 ref|XP_002322283.1| hypothetical protein POPTR_0015s11410g [Popu... 87 4e-15 ref|XP_002284270.1| PREDICTED: mitochondrial import inner membra... 87 4e-15 ref|XP_010026220.1| PREDICTED: mitochondrial import inner membra... 86 1e-14 ref|XP_006493255.1| PREDICTED: mitochondrial import inner membra... 86 1e-14 ref|XP_006436903.1| hypothetical protein CICLE_v100332302mg, par... 86 1e-14 ref|XP_007038081.1| Translocase inner membrane subunit 8 [Theobr... 85 2e-14 ref|XP_009337537.1| PREDICTED: mitochondrial import inner membra... 85 2e-14 gb|ACU15787.1| unknown [Glycine max] 85 2e-14 ref|XP_009768846.1| PREDICTED: mitochondrial import inner membra... 84 4e-14 ref|XP_010943747.1| PREDICTED: mitochondrial import inner membra... 84 5e-14 ref|XP_010926768.1| PREDICTED: mitochondrial import inner membra... 83 6e-14 ref|XP_009402168.1| PREDICTED: mitochondrial import inner membra... 83 6e-14 ref|XP_009342209.1| PREDICTED: mitochondrial import inner membra... 83 6e-14 gb|KJB46852.1| hypothetical protein B456_008G209300, partial [Go... 83 8e-14 ref|XP_012439040.1| PREDICTED: mitochondrial import inner membra... 83 8e-14 ref|XP_004241454.1| PREDICTED: mitochondrial import inner membra... 83 8e-14 >ref|XP_012090628.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Jatropha curcas] gi|282848242|gb|ADB02902.1| mitochondrial import inner membrane translocase subunit Tim8/small zinc finger-like protein [Jatropha curcas] gi|643706437|gb|KDP22569.1| hypothetical protein JCGZ_26400 [Jatropha curcas] Length = 78 Score = 90.1 bits (222), Expect = 5e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKCITSTPGSKFSS ES+CL+NCAQRYMD+SLIIMKRF+SMH Sbjct: 35 CWDKCITSTPGSKFSSSESACLSNCAQRYMDMSLIIMKRFQSMH 78 >ref|XP_002511123.1| translocase of inner mitochondrial membrane, putative [Ricinus communis] gi|223550238|gb|EEF51725.1| translocase of inner mitochondrial membrane, putative [Ricinus communis] Length = 78 Score = 89.4 bits (220), Expect = 9e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKCITSTPGSKFSS ESSCL NC QRYMD+SLIIMKRF+SMH Sbjct: 35 CWDKCITSTPGSKFSSSESSCLTNCTQRYMDMSLIIMKRFQSMH 78 >ref|XP_010250594.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Nelumbo nucifera] Length = 78 Score = 88.6 bits (218), Expect = 1e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKCIT TPGSKFSS ES+CL+NCAQRYMD+SLIIMKRF+SMH Sbjct: 35 CWDKCITGTPGSKFSSSESTCLSNCAQRYMDMSLIIMKRFQSMH 78 >emb|CDP14990.1| unnamed protein product [Coffea canephora] Length = 78 Score = 87.8 bits (216), Expect = 3e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKCITSTPGSKFSS E++CL NCAQRYMD+S+IIMKRF+SMH Sbjct: 35 CWDKCITSTPGSKFSSSETTCLTNCAQRYMDMSMIIMKRFQSMH 78 >ref|XP_002322283.1| hypothetical protein POPTR_0015s11410g [Populus trichocarpa] gi|743830968|ref|XP_011023927.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Populus euphratica] gi|118483366|gb|ABK93584.1| unknown [Populus trichocarpa] gi|222869279|gb|EEF06410.1| hypothetical protein POPTR_0015s11410g [Populus trichocarpa] Length = 78 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKCITS+PGSKFSS ESSCL+NCAQRYMD+SLIIMKRF+SM+ Sbjct: 35 CWDKCITSSPGSKFSSSESSCLSNCAQRYMDMSLIIMKRFQSMN 78 >ref|XP_002284270.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Vitis vinifera] gi|297734470|emb|CBI15717.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CL+NCAQRYMD+SLIIMKRF+SM Sbjct: 34 CWDKCITSTPGSKFSSSESTCLSNCAQRYMDMSLIIMKRFQSM 76 >ref|XP_010026220.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Eucalyptus grandis] gi|629118629|gb|KCW83119.1| hypothetical protein EUGRSUZ_B00077 [Eucalyptus grandis] Length = 78 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCIT TPGSKFSS ES+CLANCAQRYMD+S+IIMKRF+SM Sbjct: 35 CWDKCITGTPGSKFSSSESTCLANCAQRYMDMSIIIMKRFQSM 77 >ref|XP_006493255.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Citrus sinensis] gi|641845602|gb|KDO64489.1| hypothetical protein CISIN_1g034922mg [Citrus sinensis] Length = 78 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CLANCAQRY+D+S+IIMKRF+SM Sbjct: 35 CWDKCITSTPGSKFSSSESACLANCAQRYLDMSVIIMKRFQSM 77 >ref|XP_006436903.1| hypothetical protein CICLE_v100332302mg, partial [Citrus clementina] gi|557539099|gb|ESR50143.1| hypothetical protein CICLE_v100332302mg, partial [Citrus clementina] Length = 62 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CLANCAQRY+D+S+IIMKRF+SM Sbjct: 19 CWDKCITSTPGSKFSSSESACLANCAQRYLDMSVIIMKRFQSM 61 >ref|XP_007038081.1| Translocase inner membrane subunit 8 [Theobroma cacao] gi|508775326|gb|EOY22582.1| Translocase inner membrane subunit 8 [Theobroma cacao] Length = 185 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CL++CAQRYMD+SLIIMKRF+SM Sbjct: 142 CWDKCITSTPGSKFSSSESACLSHCAQRYMDMSLIIMKRFQSM 184 >ref|XP_009337537.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Pyrus x bretschneideri] Length = 78 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CLANCA+RY+D+S+IIMKRF+SM Sbjct: 35 CWDKCITSTPGSKFSSSESACLANCARRYLDMSMIIMKRFQSM 77 >gb|ACU15787.1| unknown [Glycine max] Length = 78 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKCI STPGSKFSS E++CL NC+QRYMD+S+IIMKRF+SMH Sbjct: 35 CWDKCIASTPGSKFSSSETTCLTNCSQRYMDMSMIIMKRFQSMH 78 >ref|XP_009768846.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Nicotiana sylvestris] Length = 78 Score = 84.0 bits (206), Expect = 4e-14 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSMH 133 CWDKC+T TPGSKFSS ES+CLA+CAQRYM++S IIMKRF+SMH Sbjct: 35 CWDKCVTGTPGSKFSSSESNCLAHCAQRYMEMSAIIMKRFQSMH 78 >ref|XP_010943747.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Elaeis guineensis] Length = 74 Score = 83.6 bits (205), Expect = 5e-14 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCIT TPGSKFSS ES+CL NCAQRYMD+S++IMKRF+SM Sbjct: 31 CWDKCITGTPGSKFSSSESTCLTNCAQRYMDMSILIMKRFQSM 73 >ref|XP_010926768.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Elaeis guineensis] Length = 74 Score = 83.2 bits (204), Expect = 6e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CL NCAQRY+D+S++IMKRF+SM Sbjct: 31 CWDKCITSTPGSKFSSSESTCLTNCAQRYVDMSVLIMKRFQSM 73 >ref|XP_009402168.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Musa acuminata subsp. malaccensis] Length = 74 Score = 83.2 bits (204), Expect = 6e-14 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCIT TPGSKFSS ES+CL NCAQRYMD+S++IMKRF+SM Sbjct: 31 CWDKCITGTPGSKFSSSESTCLTNCAQRYMDMSMMIMKRFQSM 73 >ref|XP_009342209.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Pyrus x bretschneideri] gi|694429370|ref|XP_009342212.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Pyrus x bretschneideri] gi|694442286|ref|XP_009347837.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Pyrus x bretschneideri] Length = 78 Score = 83.2 bits (204), Expect = 6e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCIT TPGSKFSS ES+CLANCA+RY+D+S+IIMKRF+SM Sbjct: 35 CWDKCITGTPGSKFSSSESACLANCARRYLDMSMIIMKRFQSM 77 >gb|KJB46852.1| hypothetical protein B456_008G209300, partial [Gossypium raimondii] Length = 107 Score = 82.8 bits (203), Expect = 8e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPG+KFSS ES+CL+NCAQRYMDL+LIIMKR +SM Sbjct: 64 CWDKCITSTPGNKFSSSESACLSNCAQRYMDLTLIIMKRVQSM 106 >ref|XP_012439040.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Gossypium raimondii] gi|728830784|gb|KHG10227.1| Mitochondrial import inner membrane translocase subunit Tim8 -like protein [Gossypium arboreum] Length = 78 Score = 82.8 bits (203), Expect = 8e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPG+KFSS ES+CL+NCAQRYMDL+LIIMKR +SM Sbjct: 35 CWDKCITSTPGNKFSSSESACLSNCAQRYMDLTLIIMKRVQSM 77 >ref|XP_004241454.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Solanum lycopersicum] Length = 78 Score = 82.8 bits (203), Expect = 8e-14 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = +2 Query: 2 CWDKCITSTPGSKFSSGESSCLANCAQRYMDLSLIIMKRFRSM 130 CWDKCITSTPGSKFSS ES+CL+NCAQRYM++SL+I+KRF+SM Sbjct: 35 CWDKCITSTPGSKFSSSESNCLSNCAQRYMEMSLMIVKRFQSM 77