BLASTX nr result
ID: Cinnamomum25_contig00022447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00022447 (540 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010261136.1| PREDICTED: probable root meristem growth fac... 58 3e-06 >ref|XP_010261136.1| PREDICTED: probable root meristem growth factor 8 [Nelumbo nucifera] Length = 132 Score = 57.8 bits (138), Expect = 3e-06 Identities = 44/107 (41%), Positives = 53/107 (49%), Gaps = 20/107 (18%) Frame = -1 Query: 327 CTSHRTLAYSPHDQ--------SKLPRKLRSIEVPMVQ-----ESMNGDYKSNNVKTGG- 190 C S + +S H Q +KLPRKLR +E PMVQ E DYK G Sbjct: 20 CASLQAQLHSLHPQDQDPGLLLTKLPRKLRLLEEPMVQRRYMVEDFIADYKQKGALLSGK 79 Query: 189 -STVEKLHDQVSINTREKDMQ-----QFMTMDYSRPRRRRPIHNWAV 67 +TV TR+K ++ QF TMDY+R RRRRPIHN AV Sbjct: 80 INTVGVRVRDGRQGTRQKWVEGAEAWQFFTMDYARVRRRRPIHNKAV 126