BLASTX nr result
ID: Cinnamomum25_contig00022161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00022161 (405 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008787518.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 ref|XP_010934787.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_008231329.1| PREDICTED: pentatricopeptide repeat-containi... 73 8e-11 ref|XP_009385402.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_009364299.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_008337878.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 gb|KDO48045.1| hypothetical protein CISIN_1g001642mg [Citrus sin... 67 5e-09 ref|XP_006484704.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_006437400.1| hypothetical protein CICLE_v10030585mg [Citr... 67 5e-09 ref|XP_010662220.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 emb|CBI38550.3| unnamed protein product [Vitis vinifera] 66 1e-08 emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] 66 1e-08 ref|XP_011650052.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_006827611.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_008462795.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_003570431.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_006649187.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 60 4e-07 emb|CDP15489.1| unnamed protein product [Coffea canephora] 60 6e-07 ref|XP_011466816.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_012070275.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_008787518.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Phoenix dactylifera] gi|672128082|ref|XP_008787520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Phoenix dactylifera] Length = 998 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 404 SKLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 SKLSNGAEVKRLLK MNE+GF PCESTL IS AFARPGKK A LL+++Y+ Sbjct: 945 SKLSNGAEVKRLLKEMNERGFSPCESTLRSISKAFARPGKKWLAHMLLKKMYK 997 >ref|XP_010934787.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] gi|743831754|ref|XP_010934788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] gi|743831760|ref|XP_010934789.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] gi|743831764|ref|XP_010934790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] Length = 998 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = -2 Query: 404 SKLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 SKL+NGAEVKRLLK MNE+GF PCESTL IS AFARPGKK A LL+++Y+ Sbjct: 945 SKLTNGAEVKRLLKEMNERGFSPCESTLRFISKAFARPGKKWLAHMLLKKIYK 997 >ref|XP_008231329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Prunus mume] gi|645250697|ref|XP_008231330.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Prunus mume] Length = 1025 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLY 249 K S E KRLL MNEKG+VPCESTL CIS+AFARPGKK AR+LL+ LY Sbjct: 970 KRSYRDEAKRLLTDMNEKGYVPCESTLRCISSAFARPGKKADARRLLKELY 1020 >ref|XP_009385402.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Musa acuminata subsp. malaccensis] Length = 985 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = -2 Query: 404 SKLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 SKL NG+EVKRLLK M EKGF P E TL IS AFARPG+ A+KLL +LY+ Sbjct: 932 SKLLNGSEVKRLLKEMTEKGFAPGEETLGFISKAFARPGRTLGAQKLLRKLYK 984 >ref|XP_009364299.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Pyrus x bretschneideri] Length = 1021 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLY 249 K S AE KRLL M EKG+VPCEST+ CIS+ FARPGKK A++LL+ LY Sbjct: 966 KKSYRAEAKRLLTDMKEKGYVPCESTVLCISSTFARPGKKADAQRLLKELY 1016 >ref|XP_008337878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Malus domestica] Length = 1021 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLY 249 K S AE KRLL M EKG+VPCEST+ CIS+ FARPGKK A++LL+ LY Sbjct: 966 KKSYRAEAKRLLTDMKEKGYVPCESTVLCISSTFARPGKKADAQRLLKELY 1016 >gb|KDO48045.1| hypothetical protein CISIN_1g001642mg [Citrus sinensis] gi|641828910|gb|KDO48046.1| hypothetical protein CISIN_1g001642mg [Citrus sinensis] Length = 1039 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -2 Query: 398 LSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 LS AE K+L MNEKGFVPCEST C S+ FARPGKK A++LL+ Y+ Sbjct: 985 LSYRAEAKKLFMEMNEKGFVPCESTQTCFSSTFARPGKKADAQRLLQEFYK 1035 >ref|XP_006484704.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Citrus sinensis] Length = 1039 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -2 Query: 398 LSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 LS AE K+L MNEKGFVPCEST C S+ FARPGKK A++LL+ Y+ Sbjct: 985 LSYRAEAKKLFMEMNEKGFVPCESTQTCFSSTFARPGKKADAQRLLQEFYK 1035 >ref|XP_006437400.1| hypothetical protein CICLE_v10030585mg [Citrus clementina] gi|557539596|gb|ESR50640.1| hypothetical protein CICLE_v10030585mg [Citrus clementina] Length = 1039 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -2 Query: 398 LSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 LS AE K+L MNEKGFVPCEST C S+ FARPGKK A++LL+ Y+ Sbjct: 985 LSYRAEAKKLFMEMNEKGFVPCESTQTCFSSTFARPGKKADAQRLLQEFYK 1035 >ref|XP_010662220.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Vitis vinifera] gi|731422724|ref|XP_010662221.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Vitis vinifera] Length = 850 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 K S AE KRL + MNEKGF+PCE+TL CIS A+PGKK A+++L +LY+ Sbjct: 795 KRSYQAEAKRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYK 846 >emb|CBI38550.3| unnamed protein product [Vitis vinifera] Length = 795 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 K S AE KRL + MNEKGF+PCE+TL CIS A+PGKK A+++L +LY+ Sbjct: 740 KRSYQAEAKRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYK 791 >emb|CAN66681.1| hypothetical protein VITISV_005087 [Vitis vinifera] Length = 882 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 K S AE KRL + MNEKGF+PCE+TL CIS A+PGKK A+++L +LY+ Sbjct: 740 KRSYQAEAKRLFEEMNEKGFIPCENTLACISFTLAKPGKKADAQRILNKLYK 791 >ref|XP_011650052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673749|ref|XP_011650053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673753|ref|XP_011650054.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673757|ref|XP_011650056.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|778673760|ref|XP_004151848.2| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis sativus] gi|700208231|gb|KGN63350.1| hypothetical protein Csa_2G431190 [Cucumis sativus] Length = 785 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 K+S AE KRL MN++GFVPCEST CIS+ FA PGKK AR LL+ Y+ Sbjct: 730 KISYRAEAKRLFIEMNDRGFVPCESTQACISSTFAAPGKKADARMLLKSTYK 781 >ref|XP_006827611.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Amborella trichopoda] gi|548832231|gb|ERM95027.1| hypothetical protein AMTR_s00009p00241130 [Amborella trichopoda] Length = 940 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 KLSNG +VKRLLK N+KG+ E TL I+ FA+PGK+G AR+LLER ++ Sbjct: 871 KLSNGPQVKRLLKEANDKGYSLSEDTLGLITEIFAKPGKRGQARRLLERFHK 922 >ref|XP_008462795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125653|ref|XP_008462796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125655|ref|XP_008462797.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125657|ref|XP_008462798.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125659|ref|XP_008462799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125661|ref|XP_008462800.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125663|ref|XP_008462801.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125665|ref|XP_008462802.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] gi|659125667|ref|XP_008462803.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Cucumis melo] Length = 785 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 K+S AE KRL MN++GFVP ESTL CIS+ FA PGKK AR LL+ Y+ Sbjct: 730 KISYRAEAKRLFIEMNDRGFVPSESTLACISSTFAAPGKKADARMLLKSTYK 781 >ref|XP_003570431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Brachypodium distachyon] Length = 938 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -2 Query: 404 SKLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 SKL NG EV++ LK M EKGF P + TL+ IS AF++PG AR+LL+ LY+ Sbjct: 885 SKLRNGTEVRKFLKDMKEKGFSPSKGTLSSISRAFSKPGMSWEARRLLKNLYK 937 >ref|XP_006649187.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Oryza brachyantha] Length = 1014 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 404 SKLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 S+L NG EVK +LK M EKGF P + TLN I AF++PG A++LL+ LYR Sbjct: 883 SRLRNGTEVKNILKDMKEKGFSPSKGTLNFICRAFSKPGMTWQAQRLLKNLYR 935 >emb|CDP15489.1| unnamed protein product [Coffea canephora] Length = 1003 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -2 Query: 401 KLSNGAEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 KL+ AE +RL K MN+KGF P E+T++CIS A A+PGK+ A++ LE+ Y+ Sbjct: 948 KLAYQAEARRLFKEMNDKGFTPSETTISCISPALAKPGKRVDAQRWLEKFYK 999 >ref|XP_011466816.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Fragaria vesca subsp. vesca] gi|764603733|ref|XP_011466817.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Fragaria vesca subsp. vesca] gi|764603739|ref|XP_004303063.2| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Fragaria vesca subsp. vesca] gi|764603743|ref|XP_011466818.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Fragaria vesca subsp. vesca] gi|764603747|ref|XP_011466819.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Fragaria vesca subsp. vesca] Length = 1016 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 386 AEVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLY 249 AE KRLL MNEKG+VP STL+ IS+ FARPGKK A++LL+ LY Sbjct: 966 AEAKRLLIEMNEKGYVPGGSTLSSISSTFARPGKKADAQRLLKELY 1011 >ref|XP_012070275.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Jatropha curcas] Length = 1040 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -2 Query: 383 EVKRLLKAMNEKGFVPCESTLNCISNAFARPGKKGYARKLLERLYR 246 E K+L+ MNEKGFVPCEST+ C+S+ FARPG A KLL+ Y+ Sbjct: 991 EAKKLIIEMNEKGFVPCESTIACVSSTFARPGMMLDAAKLLKETYK 1036