BLASTX nr result
ID: Cinnamomum25_contig00022146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00022146 (516 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009618083.1| PREDICTED: probable leucine-rich repeat rece... 63 7e-08 ref|XP_009762780.1| PREDICTED: probable leucine-rich repeat rece... 61 3e-07 ref|XP_010102181.1| putative leucine-rich repeat receptor-like p... 60 7e-07 ref|XP_012486859.1| PREDICTED: probable leucine-rich repeat rece... 60 7e-07 ref|XP_012486860.1| PREDICTED: probable leucine-rich repeat rece... 60 7e-07 gb|KHF98929.1| hypothetical protein F383_16784 [Gossypium arboreum] 60 7e-07 ref|XP_011082828.1| PREDICTED: leucine-rich repeat receptor-like... 59 2e-06 ref|XP_009804334.1| PREDICTED: leucine-rich repeat receptor-like... 59 2e-06 ref|XP_012569917.1| PREDICTED: probable leucine-rich repeat rece... 58 2e-06 ref|XP_009626861.1| PREDICTED: leucine-rich repeat receptor-like... 58 2e-06 ref|XP_009379722.1| PREDICTED: LOW QUALITY PROTEIN: probable leu... 58 3e-06 ref|XP_008388751.1| PREDICTED: LOW QUALITY PROTEIN: probable leu... 58 3e-06 gb|AES61158.2| LRR receptor-like kinase [Medicago truncatula] 57 4e-06 ref|XP_003590907.1| Pentatricopeptide repeat-containing protein ... 57 4e-06 ref|XP_012476731.1| PREDICTED: probable leucine-rich repeat rece... 57 5e-06 ref|XP_004488711.1| PREDICTED: leucine-rich repeat receptor-like... 57 5e-06 ref|XP_011466035.1| PREDICTED: probable leucine-rich repeat rece... 57 6e-06 ref|XP_008218374.1| PREDICTED: probable leucine-rich repeat rece... 57 6e-06 ref|XP_007207229.1| hypothetical protein PRUPE_ppa000976mg [Prun... 57 6e-06 ref|XP_004247815.1| PREDICTED: probable leucine-rich repeat rece... 57 6e-06 >ref|XP_009618083.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At2g33170 [Nicotiana tomentosiformis] gi|697128071|ref|XP_009618084.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At2g33170 [Nicotiana tomentosiformis] Length = 1102 Score = 63.2 bits (152), Expect = 7e-08 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LNEEG +LL+ KKN+ D +N LW+WNS+D TPCGW G Sbjct: 29 LNEEGMYLLDLKKNIWDQFNHLWNWNSNDETPCGWVG 65 >ref|XP_009762780.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Nicotiana sylvestris] Length = 1103 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LNEEG +LL+ KKN+ D +N LW+WN +D TPCGW G Sbjct: 30 LNEEGMYLLDLKKNIWDQFNHLWNWNPNDGTPCGWVG 66 >ref|XP_010102181.1| putative leucine-rich repeat receptor-like protein kinase [Morus notabilis] gi|587904928|gb|EXB93124.1| putative leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 1103 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/68 (45%), Positives = 40/68 (58%) Frame = -3 Query: 205 MTLLLKFHIRRISLLPLXXXXXXXXXXXXTSLNEEGKWLLEFKKNLVDNYNDLWSWNSSD 26 M++ K H +LL L LN EG++LLE K++LVD +N L +WNSSD Sbjct: 2 MSMKKKLH----TLLTLLLVLASLLVYESEGLNTEGQYLLEIKRSLVDVFNYLGNWNSSD 57 Query: 25 STPCGWSG 2 STPCGW G Sbjct: 58 STPCGWRG 65 >ref|XP_012486859.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 isoform X1 [Gossypium raimondii] Length = 1127 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EG+ LLE KK+L D YN LW+W S+D TPCGW G Sbjct: 55 LNSEGQLLLELKKSLHDEYNHLWNWKSTDETPCGWIG 91 >ref|XP_012486860.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 isoform X2 [Gossypium raimondii] gi|823177658|ref|XP_012486861.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 isoform X2 [Gossypium raimondii] gi|823177661|ref|XP_012486862.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 isoform X2 [Gossypium raimondii] gi|763770556|gb|KJB37771.1| hypothetical protein B456_006G219400 [Gossypium raimondii] gi|763770557|gb|KJB37772.1| hypothetical protein B456_006G219400 [Gossypium raimondii] Length = 1109 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EG+ LLE KK+L D YN LW+W S+D TPCGW G Sbjct: 37 LNSEGQLLLELKKSLHDEYNHLWNWKSTDETPCGWIG 73 >gb|KHF98929.1| hypothetical protein F383_16784 [Gossypium arboreum] Length = 1015 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EG+ LLE KK+L D YN LW+W S+D TPCGW G Sbjct: 32 LNSEGQLLLELKKSLHDEYNHLWNWKSTDETPCGWIG 68 >ref|XP_011082828.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 [Sesamum indicum] Length = 1098 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 115 SLNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 SLNEEG LLEFKK L D Y +L +WNSSDS+PC W+G Sbjct: 22 SLNEEGNILLEFKKPLTDPYLNLQNWNSSDSSPCNWTG 59 >ref|XP_009804334.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 [Nicotiana sylvestris] Length = 1111 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 115 SLNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 SLNEEG LLEF+K+L D YN+L SWNSSD +PC W+G Sbjct: 28 SLNEEGLILLEFRKSLNDPYNNLESWNSSDLSPCNWNG 65 >ref|XP_012569917.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Cicer arietinum] Length = 1103 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EGK+L+E K L D YN L +WNSSDS PCGW+G Sbjct: 30 LNAEGKYLMEIKLRLFDKYNHLENWNSSDSNPCGWNG 66 >ref|XP_009626861.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 [Nicotiana tomentosiformis] Length = 1111 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 115 SLNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 SLNEEG LLEF+K+L D YN+L SWNSSD +PC W+G Sbjct: 28 SLNEEGFILLEFRKSLNDPYNNLESWNSSDLSPCNWNG 65 >ref|XP_009379722.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Pyrus x bretschneideri] Length = 1110 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN+EG++LL+FK LVD ++ L SWNS+D TPCGW G Sbjct: 29 LNDEGQYLLKFKSGLVDRFDHLGSWNSNDFTPCGWRG 65 >ref|XP_008388751.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Malus domestica] Length = 1090 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN+EG++LL+FK LVD ++ L SWNS+D TPCGW G Sbjct: 29 LNDEGQYLLKFKSGLVDRFDHLGSWNSNDFTPCGWRG 65 >gb|AES61158.2| LRR receptor-like kinase [Medicago truncatula] Length = 1066 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EGK+L+ K LVD YN L +WNS DSTPCGW G Sbjct: 27 LNAEGKYLMSIKVTLVDKYNHLVNWNSIDSTPCGWKG 63 >ref|XP_003590907.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 2047 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EGK+L+ K LVD YN L +WNS DSTPCGW G Sbjct: 989 LNAEGKYLMSIKVTLVDKYNHLVNWNSIDSTPCGWKG 1025 >ref|XP_012476731.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Gossypium raimondii] gi|763759277|gb|KJB26608.1| hypothetical protein B456_004G249900 [Gossypium raimondii] Length = 1109 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN EG++LLE K+NLVD ++ L +WN +D TPCGW+G Sbjct: 33 LNSEGQYLLEIKRNLVDKFHHLSNWNPNDPTPCGWNG 69 >ref|XP_004488711.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 [Cicer arietinum] Length = 1115 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 115 SLNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 S+NEEG LL+FK +L+D+ N+L++WN SDSTPC W+G Sbjct: 30 SINEEGSNLLKFKASLLDSKNNLFNWNPSDSTPCNWTG 67 >ref|XP_011466035.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Fragaria vesca subsp. vesca] Length = 1110 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN+EG++LLE K +VD + L SWNSSD TPCGW G Sbjct: 27 LNDEGQYLLEIKSRIVDEFGHLSSWNSSDLTPCGWRG 63 >ref|XP_008218374.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g63930 [Prunus mume] Length = 1102 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN+EG++LLE K LVD ++ L SWNS+D TPCGW G Sbjct: 30 LNDEGQYLLEIKSRLVDRFDHLSSWNSNDFTPCGWRG 66 >ref|XP_007207229.1| hypothetical protein PRUPE_ppa000976mg [Prunus persica] gi|462402871|gb|EMJ08428.1| hypothetical protein PRUPE_ppa000976mg [Prunus persica] Length = 944 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN+EG++LLE K LVD ++ L SWNS+D TPCGW G Sbjct: 8 LNDEGQYLLEIKSRLVDRFDHLSSWNSNDFTPCGWRG 44 >ref|XP_004247815.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At2g33170 [Solanum lycopersicum] Length = 1109 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -3 Query: 112 LNEEGKWLLEFKKNLVDNYNDLWSWNSSDSTPCGWSG 2 LN+EG +LLE KKN D YN L +WN++D TPCGW G Sbjct: 35 LNQEGMYLLELKKNFQDPYNYLGNWNANDETPCGWVG 71