BLASTX nr result
ID: Cinnamomum25_contig00022076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00022076 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010252711.1| PREDICTED: putative DUF21 domain-containing ... 65 1e-08 ref|XP_010252709.1| PREDICTED: putative DUF21 domain-containing ... 65 1e-08 ref|XP_006346158.1| PREDICTED: putative DUF21 domain-containing ... 65 2e-08 emb|CDX82558.1| BnaA03g32630D [Brassica napus] 64 4e-08 ref|XP_004244043.1| PREDICTED: putative DUF21 domain-containing ... 64 5e-08 ref|XP_002884940.1| CBS domain-containing protein [Arabidopsis l... 64 5e-08 ref|XP_006296606.1| hypothetical protein CARUB_v10013158mg [Caps... 63 7e-08 emb|CDY23564.1| BnaC05g40300D [Brassica napus] 62 1e-07 ref|XP_010675896.1| PREDICTED: putative DUF21 domain-containing ... 62 1e-07 ref|XP_006407264.1| hypothetical protein EUTSA_v10020238mg [Eutr... 62 1e-07 ref|XP_009346765.1| PREDICTED: DUF21 domain-containing protein A... 61 3e-07 ref|XP_009146552.1| PREDICTED: putative DUF21 domain-containing ... 61 3e-07 emb|CDY44023.1| BnaA05g26180D [Brassica napus] 61 3e-07 ref|XP_008364162.1| PREDICTED: DUF21 domain-containing protein A... 61 3e-07 ref|XP_008364156.1| PREDICTED: DUF21 domain-containing protein A... 61 3e-07 ref|XP_002273722.1| PREDICTED: putative DUF21 domain-containing ... 61 3e-07 emb|CAN83218.1| hypothetical protein VITISV_018001 [Vitis vinifera] 61 3e-07 gb|KFK38642.1| hypothetical protein AALP_AA3G141400 [Arabis alpina] 61 3e-07 ref|XP_012070978.1| PREDICTED: putative DUF21 domain-containing ... 60 4e-07 gb|KDP39244.1| hypothetical protein JCGZ_01001 [Jatropha curcas] 60 4e-07 >ref|XP_010252711.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic isoform X2 [Nelumbo nucifera] Length = 602 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -1 Query: 188 EIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 E + V +RG LL +VCG F+IG C+ V AMEG L AG R F +GG+L + WPK+L Sbjct: 101 EFYEVLVKRGFLLVVMVCGAFVIG-CQGVFAMEGALSAGYRTFGQGGMLLRDVWPKLL 157 >ref|XP_010252709.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic isoform X1 [Nelumbo nucifera] Length = 675 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -1 Query: 188 EIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 E + V +RG LL +VCG F+IG C+ V AMEG L AG R F +GG+L + WPK+L Sbjct: 101 EFYEVLVKRGFLLVVMVCGAFVIG-CQGVFAMEGALSAGYRTFGQGGMLLRDVWPKLL 157 >ref|XP_006346158.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 664 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = -1 Query: 167 RRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKMLLVLK 3 ++G++L V+CGVF+IG CRRV A+EGVL+ G V E+G VL + WP +LLVL+ Sbjct: 95 KKGVILVGVICGVFIIG-CRRVFAVEGVLNGGYGVLEQGLVLLRSYWPTVLLVLR 148 >emb|CDX82558.1| BnaA03g32630D [Brassica napus] Length = 652 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/63 (52%), Positives = 44/63 (69%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 D E +V +RG+++ +VVCGVFL G CR+VLA GV++AG VF + VLFK A PK+ Sbjct: 87 DLESIKVLLKRGIVVGAVVCGVFLYG-CRKVLASAGVVEAGYEVFGQSLVLFKNALPKIY 145 Query: 14 LVL 6 VL Sbjct: 146 QVL 148 >ref|XP_004244043.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic isoform X1 [Solanum lycopersicum] Length = 662 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = -1 Query: 167 RRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKMLLVLK 3 ++G++L V+CG FLIG CRRV A+EGVL+ G V E+G VL + WP +LLVL+ Sbjct: 92 KKGVILVGVICGFFLIG-CRRVFAVEGVLNGGYGVLEQGLVLLRSYWPTVLLVLR 145 >ref|XP_002884940.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330780|gb|EFH61199.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 660 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + E +V +RG++L +VVCGVFL G C++VLA GV++AG VF + VLFK A PK+ Sbjct: 94 ELESIKVLLKRGIVLGAVVCGVFLYG-CQKVLASAGVMEAGYEVFGQSVVLFKNALPKIY 152 Query: 14 LVLK 3 VL+ Sbjct: 153 QVLR 156 >ref|XP_006296606.1| hypothetical protein CARUB_v10013158mg [Capsella rubella] gi|482565315|gb|EOA29504.1| hypothetical protein CARUB_v10013158mg [Capsella rubella] Length = 661 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + E +V +RG+++ +VVCGVFL G C++VLA GV++AG VF + VLFK A PK+ Sbjct: 94 ELESIKVLLKRGIVVGAVVCGVFLYG-CQKVLASAGVVEAGYEVFGQSVVLFKNALPKIY 152 Query: 14 LVLK 3 VLK Sbjct: 153 QVLK 156 >emb|CDY23564.1| BnaC05g40300D [Brassica napus] Length = 588 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/64 (48%), Positives = 45/64 (70%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + E +V +RG+++ +VVCGV+L G C++VLA GV++AG VF + VLFK A PK+ Sbjct: 20 ELEWIKVLLKRGIVIGAVVCGVYLYG-CKKVLASSGVVEAGYEVFGQSLVLFKNALPKIY 78 Query: 14 LVLK 3 VLK Sbjct: 79 QVLK 82 >ref|XP_010675896.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870861648|gb|KMT12920.1| hypothetical protein BVRB_4g090040 [Beta vulgaris subsp. vulgaris] Length = 676 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 +FE +V + G+ LA++VCG FL CRRV+A EGV++AG V + +L K AWPK L Sbjct: 93 NFESMKVLLKNGMFLAAIVCGAFLFE-CRRVMAAEGVVNAGYGVIGQSILLLKSAWPKTL 151 Query: 14 LVL 6 VL Sbjct: 152 QVL 154 >ref|XP_006407264.1| hypothetical protein EUTSA_v10020238mg [Eutrema salsugineum] gi|557108410|gb|ESQ48717.1| hypothetical protein EUTSA_v10020238mg [Eutrema salsugineum] Length = 660 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/64 (48%), Positives = 45/64 (70%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + E +V +RG+++ +VVCGVFL G C++VLA GV++AG VF + VLFK A PK+ Sbjct: 94 ELESIKVLLKRGIVIGAVVCGVFLYG-CQKVLASAGVVEAGYEVFGQSLVLFKNALPKIY 152 Query: 14 LVLK 3 VL+ Sbjct: 153 QVLR 156 >ref|XP_009346765.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Pyrus x bretschneideri] Length = 665 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 191 FEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKMLL 12 F+ + + G++LA+VVCGV LI GCRR A+EGV++AG V + +L + AWPK LL Sbjct: 97 FDFVKELVKCGVVLAAVVCGV-LIYGCRRAFAVEGVINAGYGVIGQSILLLRNAWPKTLL 155 Query: 11 VLK 3 VL+ Sbjct: 156 VLQ 158 >ref|XP_009146552.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic [Brassica rapa] Length = 661 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLA-MEGVLDAGVRVFEKGGVLFKGAWPKM 18 + E+ +V +RG+++ +VVCGV+L GC++VLA GV++AG VF +G VLFK A PK+ Sbjct: 92 ELELIKVLLKRGIVIGAVVCGVYLY-GCKKVLASSSGVVEAGHEVFGQGLVLFKNALPKI 150 Query: 17 LLVLK 3 VLK Sbjct: 151 YQVLK 155 >emb|CDY44023.1| BnaA05g26180D [Brassica napus] Length = 661 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLA-MEGVLDAGVRVFEKGGVLFKGAWPKM 18 + E+ +V +RG+++ +VVCGV+L GC++VLA GV++AG VF +G VLFK A PK+ Sbjct: 92 ELELIKVLLKRGIVIGAVVCGVYLY-GCKKVLASSSGVVEAGHEVFGQGLVLFKNALPKI 150 Query: 17 LLVLK 3 VLK Sbjct: 151 YQVLK 155 >ref|XP_008364162.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like isoform X2 [Malus domestica] Length = 665 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 191 FEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKMLL 12 F+ + + G++LA+VVCGV LI GCRR A+EGV++AG V + +L + AWPK LL Sbjct: 97 FDFVKELVKCGVVLAAVVCGV-LIYGCRRAFAVEGVINAGYGVIGQSILLLRNAWPKTLL 155 Query: 11 VLK 3 VL+ Sbjct: 156 VLQ 158 >ref|XP_008364156.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like isoform X1 [Malus domestica] Length = 676 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 191 FEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKMLL 12 F+ + + G++LA+VVCGV LI GCRR A+EGV++AG V + +L + AWPK LL Sbjct: 97 FDFVKELVKCGVVLAAVVCGV-LIYGCRRAFAVEGVINAGYGVIGQSILLLRNAWPKTLL 155 Query: 11 VLK 3 VL+ Sbjct: 156 VLQ 158 >ref|XP_002273722.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic [Vitis vinifera] Length = 669 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/64 (45%), Positives = 44/64 (68%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + + F V RRG++L ++VCGV ++G C RV A+EGV+DA V + V+ +GAWPK L Sbjct: 86 NLDFFGVLLRRGVVLGAMVCGVLVLG-CSRVFAVEGVVDADYGVLRRTMVVLRGAWPKTL 144 Query: 14 LVLK 3 +L+ Sbjct: 145 QLLR 148 >emb|CAN83218.1| hypothetical protein VITISV_018001 [Vitis vinifera] Length = 723 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/64 (45%), Positives = 44/64 (68%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + + F V RRG++L ++VCGV ++G C RV A+EGV+DA V + V+ +GAWPK L Sbjct: 86 NLDFFGVLLRRGVVLGAMVCGVLVLG-CSRVFAVEGVVDADYGVLRRTMVVLRGAWPKTL 144 Query: 14 LVLK 3 +L+ Sbjct: 145 QLLR 148 >gb|KFK38642.1| hypothetical protein AALP_AA3G141400 [Arabis alpina] Length = 656 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/64 (46%), Positives = 45/64 (70%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 + E +V +RG+++ +VVCGVFL G C++VLA GV++AG VF + V+FK A PK+ Sbjct: 93 ELEAIKVLLKRGIVVGAVVCGVFLYG-CQKVLASAGVVEAGYEVFGQSIVVFKNALPKIY 151 Query: 14 LVLK 3 VL+ Sbjct: 152 QVLR 155 >ref|XP_012070978.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic [Jatropha curcas] Length = 668 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/64 (43%), Positives = 44/64 (68%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 D E+ R+ +R +LL ++VCG+ L+ GCRRV A EGV++AG V + +L + AWPK+ Sbjct: 94 DLELIRLLVKRAVLLGAMVCGI-LVFGCRRVFATEGVVNAGYGVIGQSILLLRSAWPKLS 152 Query: 14 LVLK 3 +L+ Sbjct: 153 QLLR 156 >gb|KDP39244.1| hypothetical protein JCGZ_01001 [Jatropha curcas] Length = 578 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/64 (43%), Positives = 44/64 (68%) Frame = -1 Query: 194 DFEIFRVFARRGLLLASVVCGVFLIGGCRRVLAMEGVLDAGVRVFEKGGVLFKGAWPKML 15 D E+ R+ +R +LL ++VCG+ L+ GCRRV A EGV++AG V + +L + AWPK+ Sbjct: 4 DLELIRLLVKRAVLLGAMVCGI-LVFGCRRVFATEGVVNAGYGVIGQSILLLRSAWPKLS 62 Query: 14 LVLK 3 +L+ Sbjct: 63 QLLR 66