BLASTX nr result
ID: Cinnamomum25_contig00021459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00021459 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008791433.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_002267928.2| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 emb|CBI22543.3| unnamed protein product [Vitis vinifera] 69 9e-10 emb|CAN59994.1| hypothetical protein VITISV_012660 [Vitis vinifera] 69 9e-10 ref|XP_010023746.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009352053.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_008382626.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_008234886.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 emb|CDP04662.1| unnamed protein product [Coffea canephora] 63 9e-08 ref|XP_002513583.1| pentatricopeptide repeat-containing protein,... 62 2e-07 ref|XP_006350580.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012090716.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_012858573.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-07 emb|CDX93594.1| BnaA06g04540D [Brassica napus] 60 6e-07 gb|KEH30921.1| PPR containing plant-like protein [Medicago trunc... 60 6e-07 gb|AES90248.2| PPR containing plant-like protein [Medicago trunc... 60 6e-07 gb|EYU19624.1| hypothetical protein MIMGU_mgv1a024903mg, partial... 60 6e-07 ref|XP_003608051.1| Pentatricopeptide repeat-containing protein ... 60 6e-07 ref|XP_010097855.1| hypothetical protein L484_011454 [Morus nota... 60 7e-07 ref|XP_007156522.1| hypothetical protein PHAVU_003G293100g [Phas... 59 1e-06 >ref|XP_008791433.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Phoenix dactylifera] Length = 746 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/70 (45%), Positives = 48/70 (68%) Frame = -3 Query: 210 RHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPHRTV 31 RHWK ++ + NP + F+HN L +S N+ ++ + +G+L++ARQLFD MP RTV Sbjct: 24 RHWKHKQ-FHNPKLPSTFHHNGVCPLRETISLNMQLSRYINKGDLNSARQLFDAMPQRTV 82 Query: 30 VSWNAIISAY 1 VSWNA+IS + Sbjct: 83 VSWNAMISGF 92 >ref|XP_002267928.2| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Vitis vinifera] Length = 729 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/73 (45%), Positives = 49/73 (67%) Frame = -3 Query: 219 SLSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPH 40 S+S+ WK +R + + Y +L ++S NI+I+ +A++ +LD ARQLFDQMP Sbjct: 7 SISKAWKHQR-----LKEFKLYTAHQSNLSEIISTNIAISNYAKQSKLDVARQLFDQMPQ 61 Query: 39 RTVVSWNAIISAY 1 RTVVSWN +IS+Y Sbjct: 62 RTVVSWNTMISSY 74 >emb|CBI22543.3| unnamed protein product [Vitis vinifera] Length = 728 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/73 (45%), Positives = 49/73 (67%) Frame = -3 Query: 219 SLSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPH 40 S+S+ WK +R + + Y +L ++S NI+I+ +A++ +LD ARQLFDQMP Sbjct: 6 SISKAWKHQR-----LKEFKLYTAHQSNLSEIISTNIAISNYAKQSKLDVARQLFDQMPQ 60 Query: 39 RTVVSWNAIISAY 1 RTVVSWN +IS+Y Sbjct: 61 RTVVSWNTMISSY 73 >emb|CAN59994.1| hypothetical protein VITISV_012660 [Vitis vinifera] Length = 768 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/73 (45%), Positives = 49/73 (67%) Frame = -3 Query: 219 SLSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPH 40 S+S+ WK +R + + Y +L ++S NI+I+ +A++ +LD ARQLFDQMP Sbjct: 46 SISKAWKHQR-----LKEFKLYTAHQSNLSEIISTNIAISNYAKQSKLDVARQLFDQMPQ 100 Query: 39 RTVVSWNAIISAY 1 RTVVSWN +IS+Y Sbjct: 101 RTVVSWNTMISSY 113 >ref|XP_010023746.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Eucalyptus grandis] gi|702441501|ref|XP_010023747.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Eucalyptus grandis] gi|702441505|ref|XP_010023748.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Eucalyptus grandis] gi|702441510|ref|XP_010023749.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Eucalyptus grandis] Length = 716 Score = 68.6 bits (166), Expect = 2e-09 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 2/77 (2%) Frame = -3 Query: 225 STSLSRHWKRRRRWMNPTSKARF--YHNPNKSLPHVVSCNISITTHAQRGELDTARQLFD 52 +TS+ R W R W N K F + S P +V+ NI IT HA+ G+LD AR+LFD Sbjct: 4 TTSVGRAW-RFVGWKNLKKKHSFSTFRRTTTSRPDIVAANILITQHARGGQLDVARRLFD 62 Query: 51 QMPHRTVVSWNAIISAY 1 +M RTVVSWN II+ Y Sbjct: 63 EMSERTVVSWNTIIAGY 79 >ref|XP_009352053.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Pyrus x bretschneideri] Length = 722 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -3 Query: 222 TSLSRHWKRRRRWMNPTSKARFYHNPNKSL-PHVVSCNISITTHAQRGELDTARQLFDQM 46 T ++ WK R N + ++ K+ P++VS NI IT H + G+LD AR++FD+M Sbjct: 16 TLMAGTWKHNRWKPNLEQFSTLHYKTTKTQDPNIVSTNICITRHCKSGQLDVARKVFDEM 75 Query: 45 PHRTVVSWNAIISAY 1 P RTVVSWN +IS Y Sbjct: 76 PIRTVVSWNTMISGY 90 >ref|XP_008382626.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06140, mitochondrial-like [Malus domestica] gi|658016869|ref|XP_008343786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06140, mitochondrial-like [Malus domestica] Length = 705 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 204 WKRRRRWMNPTSKARFYHNPNKSL-PHVVSCNISITTHAQRGELDTARQLFDQMPHRTVV 28 WK R N + ++ K+ P++VS NI IT H + G+LD AR++FD+MP RTVV Sbjct: 5 WKHNRWKPNLEQFSTLHYKTTKTQDPNIVSTNICITRHCKSGQLDVARKMFDEMPMRTVV 64 Query: 27 SWNAIISAY 1 SWN +IS Y Sbjct: 65 SWNTMISGY 73 >ref|XP_008234886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Prunus mume] Length = 719 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/68 (44%), Positives = 43/68 (63%) Frame = -3 Query: 204 WKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPHRTVVS 25 WKR R N + Y + +VS N+ IT +++ G+LD AR++FD+MP RTVVS Sbjct: 7 WKRSRWKPNVKQLSTLYQPAKTLVSDIVSTNVCITRYSKCGQLDVARKVFDEMPIRTVVS 66 Query: 24 WNAIISAY 1 WNA++S Y Sbjct: 67 WNAMVSGY 74 >emb|CDP04662.1| unnamed protein product [Coffea canephora] Length = 733 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 6/74 (8%) Frame = -3 Query: 204 WKRRRRWMNPTSKARFYHNPNKSLPH------VVSCNISITTHAQRGELDTARQLFDQMP 43 WK RR W + + R + + PH + S N++IT H + G+L+ AR++FD+MP Sbjct: 11 WKHRR-WKSMSGFYRTVPDGRRQGPHCSRYKGIKSMNMTITWHVKNGQLEQARRVFDEMP 69 Query: 42 HRTVVSWNAIISAY 1 RTVVSWNA+IS Y Sbjct: 70 ERTVVSWNAMISGY 83 >ref|XP_002513583.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547491|gb|EEF48986.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 61.6 bits (148), Expect = 2e-07 Identities = 34/73 (46%), Positives = 42/73 (57%) Frame = -3 Query: 219 SLSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPH 40 SL WK R W + H P VS NI+IT +A +G+LD AR LFD+MP Sbjct: 5 SLPGKWKHNR-WKVVKCYSTHVHVSRSDDPCTVSTNIAITRYAIKGQLDFARCLFDKMPQ 63 Query: 39 RTVVSWNAIISAY 1 RT VSWN +IS+Y Sbjct: 64 RTSVSWNTMISSY 76 >ref|XP_006350580.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Solanum tuberosum] Length = 731 Score = 61.6 bits (148), Expect = 2e-07 Identities = 34/81 (41%), Positives = 50/81 (61%), Gaps = 8/81 (9%) Frame = -3 Query: 219 SLSRHWKRRR-RWMNPTSKARFY-------HNPNKSLPHVVSCNISITTHAQRGELDTAR 64 S + WK R +W RF+ +N + S+ +VVS NI+IT A++G L+ AR Sbjct: 6 SFTGTWKHHRWKW-----SLRFHSNMCCNSNNTHPSISNVVSTNIAITELAKKGSLEQAR 60 Query: 63 QLFDQMPHRTVVSWNAIISAY 1 +LFD+MP R++VSWN +IS Y Sbjct: 61 KLFDEMPQRSIVSWNTMISGY 81 >ref|XP_012090716.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Jatropha curcas] gi|643706036|gb|KDP22168.1| hypothetical protein JCGZ_25999 [Jatropha curcas] Length = 730 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = -3 Query: 165 ARF-YHN--PNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPHRTVVSWNAIISAY 1 ARF +H+ P + +VS N++IT +A++G+LD AR LFD+MP RT VSWN +IS Y Sbjct: 19 ARFSFHSQTPGRGDSRIVSTNVAITHNAEKGQLDFARYLFDKMPKRTAVSWNTMISGY 76 >ref|XP_012858573.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Erythranthe guttatus] Length = 697 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/74 (43%), Positives = 43/74 (58%) Frame = -3 Query: 222 TSLSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMP 43 +S S WK +R +P P +VS N +IT+ Q GE++ ARQLFD+M Sbjct: 23 SSFSGTWKHQRWKESPI------------YPDIVSANKAITSSYQAGEIERARQLFDEMT 70 Query: 42 HRTVVSWNAIISAY 1 HRTVVSWN +I+ Y Sbjct: 71 HRTVVSWNTMITGY 84 >emb|CDX93594.1| BnaA06g04540D [Brassica napus] Length = 686 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 129 HVVSCNISITTHAQRGELDTARQLFDQMPHRTVVSWNAIISAY 1 HVVSC IT +A RG++ TAR++FD+MP R VVSWNA+I+ Y Sbjct: 144 HVVSCTALITGYASRGDVRTARKMFDEMPERDVVSWNAMITGY 186 >gb|KEH30921.1| PPR containing plant-like protein [Medicago truncatula] Length = 576 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 43/72 (59%) Frame = -3 Query: 216 LSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPHR 37 +S WKR+++ T+ PHV+S NISI HA+ G+L AR +FD+MP R Sbjct: 10 VSTTWKRKQKLQFFTT---LLEASQPYPPHVISTNISIAHHAKTGKLVEARHMFDEMPLR 66 Query: 36 TVVSWNAIISAY 1 TV SWN +IS Y Sbjct: 67 TVSSWNTMISGY 78 >gb|AES90248.2| PPR containing plant-like protein [Medicago truncatula] Length = 724 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 43/72 (59%) Frame = -3 Query: 216 LSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPHR 37 +S WKR+++ T+ PHV+S NISI HA+ G+L AR +FD+MP R Sbjct: 10 VSTTWKRKQKLQFFTT---LLEASQPYPPHVISTNISIAHHAKTGKLVEARHMFDEMPLR 66 Query: 36 TVVSWNAIISAY 1 TV SWN +IS Y Sbjct: 67 TVSSWNTMISGY 78 >gb|EYU19624.1| hypothetical protein MIMGU_mgv1a024903mg, partial [Erythranthe guttata] Length = 633 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/74 (43%), Positives = 43/74 (58%) Frame = -3 Query: 222 TSLSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMP 43 +S S WK +R +P P +VS N +IT+ Q GE++ ARQLFD+M Sbjct: 45 SSFSGTWKHQRWKESPI------------YPDIVSANKAITSSYQAGEIERARQLFDEMT 92 Query: 42 HRTVVSWNAIISAY 1 HRTVVSWN +I+ Y Sbjct: 93 HRTVVSWNTMITGY 106 >ref|XP_003608051.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 763 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/72 (44%), Positives = 43/72 (59%) Frame = -3 Query: 216 LSRHWKRRRRWMNPTSKARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPHR 37 +S WKR+++ T+ PHV+S NISI HA+ G+L AR +FD+MP R Sbjct: 10 VSTTWKRKQKLQFFTT---LLEASQPYPPHVISTNISIAHHAKTGKLVEARHMFDEMPLR 66 Query: 36 TVVSWNAIISAY 1 TV SWN +IS Y Sbjct: 67 TVSSWNTMISGY 78 >ref|XP_010097855.1| hypothetical protein L484_011454 [Morus notabilis] gi|587883535|gb|EXB72452.1| hypothetical protein L484_011454 [Morus notabilis] Length = 730 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/73 (41%), Positives = 42/73 (57%), Gaps = 5/73 (6%) Frame = -3 Query: 204 WKRRRRWMNPTSK-----ARFYHNPNKSLPHVVSCNISITTHAQRGELDTARQLFDQMPH 40 W+ + ++ P S + YHN S N+S+T + G LD AR++FD+MPH Sbjct: 17 WRWKEKYFKPFSSLLSQASTPYHND------AFSTNVSMTRLCENGRLDIARKMFDEMPH 70 Query: 39 RTVVSWNAIISAY 1 RTVVSWN +IS Y Sbjct: 71 RTVVSWNTMISGY 83 >ref|XP_007156522.1| hypothetical protein PHAVU_003G293100g [Phaseolus vulgaris] gi|561029876|gb|ESW28516.1| hypothetical protein PHAVU_003G293100g [Phaseolus vulgaris] Length = 728 Score = 59.3 bits (142), Expect = 1e-06 Identities = 34/71 (47%), Positives = 39/71 (54%), Gaps = 3/71 (4%) Frame = -3 Query: 204 WKRRRRWMNPTSKARFYHNPNKSLPHV---VSCNISITTHAQRGELDTARQLFDQMPHRT 34 WKR R N + F S PHV +S NISI G L+ AR LFDQMPHRT Sbjct: 13 WKRNRWKWNQRFRL-FTTQLQASEPHVGFVISTNISIAKRFNMGNLEEARHLFDQMPHRT 71 Query: 33 VVSWNAIISAY 1 V SWN ++S Y Sbjct: 72 VSSWNTMLSGY 82