BLASTX nr result
ID: Cinnamomum25_contig00021289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00021289 (417 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010273997.1| PREDICTED: phenylalanine ammonia-lyase-like ... 56 8e-06 >ref|XP_010273997.1| PREDICTED: phenylalanine ammonia-lyase-like [Nelumbo nucifera] Length = 745 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 316 ASEGIPRPMDACRPPTLPLPKDGKNPISVSGNAY 417 A+ GI P+D CRPPTLP+PKDGKNPI V+G++Y Sbjct: 2 ATSGIRHPVDNCRPPTLPIPKDGKNPIWVAGDSY 35