BLASTX nr result
ID: Cinnamomum25_contig00020586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00020586 (217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008244994.1| PREDICTED: jmjC domain-containing protein 4 ... 77 6e-12 ref|XP_010248583.1| PREDICTED: jmjC domain-containing protein 4 ... 76 8e-12 ref|XP_012080013.1| PREDICTED: jmjC domain-containing protein 4 ... 75 1e-11 ref|XP_002511357.1| transcription factor, putative [Ricinus comm... 75 1e-11 ref|XP_007138038.1| hypothetical protein PHAVU_009G175900g [Phas... 75 2e-11 gb|KDP31061.1| hypothetical protein JCGZ_11437 [Jatropha curcas] 74 3e-11 ref|XP_007209966.1| hypothetical protein PRUPE_ppa004952mg [Prun... 74 5e-11 ref|XP_011046192.1| PREDICTED: jmjC domain-containing protein 4 ... 73 6e-11 ref|XP_011046191.1| PREDICTED: jmjC domain-containing protein 4 ... 73 6e-11 ref|XP_007036376.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 73 8e-11 ref|XP_007036375.1| 2-oxoglutarate and Fe(II)-dependent oxygenas... 73 8e-11 ref|XP_004298971.1| PREDICTED: jmjC domain-containing protein 4 ... 73 8e-11 ref|XP_002322181.1| transcription factor jumonji domain-containi... 72 1e-10 ref|XP_010678820.1| PREDICTED: jmjC domain-containing protein 4 ... 71 2e-10 ref|XP_008464540.1| PREDICTED: jmjC domain-containing protein 4 ... 71 2e-10 ref|XP_006344435.1| PREDICTED: jmjC domain-containing protein 4-... 71 2e-10 ref|NP_001234167.2| anti-PCD protein-like [Solanum lycopersicum] 70 5e-10 ref|XP_010663130.1| PREDICTED: jmjC domain-containing protein 4 ... 70 5e-10 ref|XP_010663128.1| PREDICTED: jmjC domain-containing protein 4 ... 70 5e-10 ref|XP_009362968.1| PREDICTED: jmjC domain-containing protein 4 ... 70 5e-10 >ref|XP_008244994.1| PREDICTED: jmjC domain-containing protein 4 [Prunus mume] Length = 484 Score = 76.6 bits (187), Expect = 6e-12 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ I G++EK+NG +LSYH+F ERY+EKN+PVVLTGLMD+WRA Sbjct: 1 MGIKIAGQIEKVNGKELSYHEFVERYMEKNQPVVLTGLMDDWRA 44 >ref|XP_010248583.1| PREDICTED: jmjC domain-containing protein 4 [Nelumbo nucifera] Length = 493 Score = 76.3 bits (186), Expect = 8e-12 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MGLNIGG VEK+NG +LSY +F +RYLEKN+PVVLTGLMD+W+A Sbjct: 1 MGLNIGGHVEKVNGKELSYSEFVKRYLEKNQPVVLTGLMDDWKA 44 >ref|XP_012080013.1| PREDICTED: jmjC domain-containing protein 4 [Jatropha curcas] Length = 486 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = -2 Query: 144 RIQSMGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 R + MG+ IGG++EK+NG +LSY++F ERYL KN+PVVLTGLMD+WRA Sbjct: 8 REREMGIEIGGQIEKVNGKELSYNEFIERYLAKNQPVVLTGLMDDWRA 55 >ref|XP_002511357.1| transcription factor, putative [Ricinus communis] gi|223550472|gb|EEF51959.1| transcription factor, putative [Ricinus communis] Length = 462 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG +EK+NG +LSY +F ERYL KN+PVVLTGLMDNWRA Sbjct: 1 MGIEIGGRIEKVNGKELSYDEFVERYLSKNQPVVLTGLMDNWRA 44 >ref|XP_007138038.1| hypothetical protein PHAVU_009G175900g [Phaseolus vulgaris] gi|561011125|gb|ESW10032.1| hypothetical protein PHAVU_009G175900g [Phaseolus vulgaris] Length = 489 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/49 (67%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 141 IQSMGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMD--NWRA 1 ++ MG+NI GE+E++NG +LSY +F ERY+EKNKPVVLTGLMD NWRA Sbjct: 2 VRGMGMNIKGEIERVNGKELSYSEFVERYMEKNKPVVLTGLMDPHNWRA 50 >gb|KDP31061.1| hypothetical protein JCGZ_11437 [Jatropha curcas] Length = 475 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG++EK+NG +LSY++F ERYL KN+PVVLTGLMD+WRA Sbjct: 1 MGIEIGGQIEKVNGKELSYNEFIERYLAKNQPVVLTGLMDDWRA 44 >ref|XP_007209966.1| hypothetical protein PRUPE_ppa004952mg [Prunus persica] gi|462405701|gb|EMJ11165.1| hypothetical protein PRUPE_ppa004952mg [Prunus persica] Length = 484 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG++EK+NG +LSY +F ERY+EKN PVVLTGLMD+W+A Sbjct: 1 MGIKIGGQIEKVNGKELSYDEFVERYMEKNHPVVLTGLMDDWKA 44 >ref|XP_011046192.1| PREDICTED: jmjC domain-containing protein 4 isoform X2 [Populus euphratica] Length = 418 Score = 73.2 bits (178), Expect = 6e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG +EK+NG ++SY++F ERYL KN+PVVLTGLMD+WRA Sbjct: 1 MGIEIGGSIEKVNGKEISYNEFVERYLAKNQPVVLTGLMDDWRA 44 >ref|XP_011046191.1| PREDICTED: jmjC domain-containing protein 4 isoform X1 [Populus euphratica] Length = 488 Score = 73.2 bits (178), Expect = 6e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG +EK+NG ++SY++F ERYL KN+PVVLTGLMD+WRA Sbjct: 1 MGIEIGGSIEKVNGKEISYNEFVERYLAKNQPVVLTGLMDDWRA 44 >ref|XP_007036376.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein isoform 2, partial [Theobroma cacao] gi|508773621|gb|EOY20877.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein isoform 2, partial [Theobroma cacao] Length = 367 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG++EK+NG +LSY +FAERYL KN+PVVLTGLMD+W A Sbjct: 1 MGIKIGGQIEKVNGRELSYSEFAERYLAKNQPVVLTGLMDDWGA 44 >ref|XP_007036375.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative isoform 1 [Theobroma cacao] gi|508773620|gb|EOY20876.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative isoform 1 [Theobroma cacao] Length = 549 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG++EK+NG +LSY +FAERYL KN+PVVLTGLMD+W A Sbjct: 1 MGIKIGGQIEKVNGRELSYSEFAERYLAKNQPVVLTGLMDDWGA 44 >ref|XP_004298971.1| PREDICTED: jmjC domain-containing protein 4 [Fragaria vesca subsp. vesca] Length = 475 Score = 72.8 bits (177), Expect = 8e-11 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGGE+E++NG ++SY +F ERY+EKN+PVVLTGLM++WRA Sbjct: 1 MGITIGGEIERVNGKEVSYSEFVERYMEKNQPVVLTGLMEDWRA 44 >ref|XP_002322181.1| transcription factor jumonji domain-containing family protein [Populus trichocarpa] gi|222869177|gb|EEF06308.1| transcription factor jumonji domain-containing family protein [Populus trichocarpa] Length = 553 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG +EK+NG ++SY++F ERYL KN+PVVLTGLMD+W+A Sbjct: 1 MGIEIGGSIEKVNGKEISYNEFVERYLAKNQPVVLTGLMDDWKA 44 >ref|XP_010678820.1| PREDICTED: jmjC domain-containing protein 4 [Beta vulgaris subsp. vulgaris] gi|870859178|gb|KMT10642.1| hypothetical protein BVRB_5g117600 [Beta vulgaris subsp. vulgaris] Length = 490 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = -2 Query: 129 GLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 GLNIGGE+E++NG +LSY +F + YL KNKPV+LTGLMD+W+A Sbjct: 9 GLNIGGEIERVNGKELSYTEFVKNYLTKNKPVILTGLMDDWKA 51 >ref|XP_008464540.1| PREDICTED: jmjC domain-containing protein 4 isoform X1 [Cucumis melo] Length = 481 Score = 71.2 bits (173), Expect = 2e-10 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ I GE++K+NG LSY +F ERY+EKNKPVVLTGLMD+W+A Sbjct: 2 MGIEICGEIDKVNGKGLSYKEFVERYMEKNKPVVLTGLMDDWKA 45 >ref|XP_006344435.1| PREDICTED: jmjC domain-containing protein 4-like isoform X1 [Solanum tuberosum] Length = 460 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MGL IGG +EK+NG +L+Y +FAE+Y+ +N+PVVLTGLMD+WRA Sbjct: 1 MGLKIGGRIEKVNGRELTYSEFAEKYMSQNQPVVLTGLMDDWRA 44 >ref|NP_001234167.2| anti-PCD protein-like [Solanum lycopersicum] Length = 474 Score = 70.1 bits (170), Expect = 5e-10 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MGL IGG +EK+NG +L+Y +FAE+Y+ +N+PV+LTGLMD+WRA Sbjct: 1 MGLKIGGRIEKVNGRELTYSEFAEKYMSQNQPVLLTGLMDDWRA 44 >ref|XP_010663130.1| PREDICTED: jmjC domain-containing protein 4 isoform X3 [Vitis vinifera] Length = 366 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MGL IGGE+EK NG +LSY F ERYL KN+PVVL GLMD WRA Sbjct: 1 MGLRIGGEIEKENGDELSYSDFVERYLMKNRPVVLRGLMDGWRA 44 >ref|XP_010663128.1| PREDICTED: jmjC domain-containing protein 4 isoform X1 [Vitis vinifera] Length = 522 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MGL IGGE+EK NG +LSY F ERYL KN+PVVL GLMD WRA Sbjct: 1 MGLRIGGEIEKENGDELSYSDFVERYLMKNRPVVLRGLMDGWRA 44 >ref|XP_009362968.1| PREDICTED: jmjC domain-containing protein 4 [Pyrus x bretschneideri] Length = 474 Score = 70.1 bits (170), Expect = 5e-10 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = -2 Query: 132 MGLNIGGEVEKINGTDLSYHQFAERYLEKNKPVVLTGLMDNWRA 1 MG+ IGG++EK++G + Y++F ERY+EKN+PVVLTGLMD+WRA Sbjct: 1 MGVQIGGQIEKVSGKKVGYNEFVERYMEKNQPVVLTGLMDDWRA 44