BLASTX nr result
ID: Cinnamomum25_contig00020293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00020293 (439 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273246.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 87 6e-15 emb|CAN62825.1| hypothetical protein VITISV_003206 [Vitis vinifera] 87 6e-15 ref|XP_010244334.1| PREDICTED: xaa-Pro aminopeptidase 1-like [Ne... 84 4e-14 ref|XP_008795631.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 82 1e-13 ref|XP_008795630.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 82 1e-13 ref|XP_010943163.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 81 2e-13 ref|XP_010943162.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 81 2e-13 ref|XP_010254935.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 80 5e-13 ref|XP_010029829.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 78 2e-12 gb|KCW56801.1| hypothetical protein EUGRSUZ_I02469 [Eucalyptus g... 78 2e-12 ref|XP_008338160.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 78 3e-12 ref|XP_008241633.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 78 3e-12 ref|XP_007204612.1| hypothetical protein PRUPE_ppa002705mg [Prun... 78 3e-12 ref|XP_011099591.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 77 6e-12 gb|KHN36146.1| Putative Xaa-Pro aminopeptidase P [Glycine soja] 76 8e-12 ref|XP_009414759.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 76 8e-12 ref|XP_009414758.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 76 8e-12 ref|NP_001276265.1| probable Xaa-Pro aminopeptidase P-like [Glyc... 76 1e-11 ref|XP_007047006.1| Aminopeptidase P1 isoform 1 [Theobroma cacao... 75 2e-11 ref|XP_010667693.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 75 2e-11 >ref|XP_002273246.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Vitis vinifera] gi|297735202|emb|CBI17564.3| unnamed protein product [Vitis vinifera] Length = 642 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQKKL+D SLLT EE++WVN+YH+TCR +LAPY+DE EMAWL R+TEP+S Sbjct: 592 YQKKLIDQSLLTPEEIEWVNSYHSTCRDILAPYLDESEMAWLKRSTEPLS 641 >emb|CAN62825.1| hypothetical protein VITISV_003206 [Vitis vinifera] Length = 240 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQKKL+D SLLT EE++WVN+YH+TCR +LAPY+DE EMAWL R+TEP+S Sbjct: 190 YQKKLIDQSLLTPEEIEWVNSYHSTCRDILAPYLDESEMAWLKRSTEPLS 239 >ref|XP_010244334.1| PREDICTED: xaa-Pro aminopeptidase 1-like [Nelumbo nucifera] Length = 451 Score = 84.0 bits (206), Expect = 4e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQKKLMD LLT EE++WVNAYHA CR+VL P++DE EMAWL +ATEPIS Sbjct: 401 YQKKLMDLKLLTPEEIEWVNAYHARCREVLEPFLDETEMAWLKKATEPIS 450 >ref|XP_008795631.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Phoenix dactylifera] Length = 600 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQKKLMD +LLT EE++W+NAYHA CRK LAPY+ E EM WL +ATEPI Sbjct: 548 YQKKLMDLTLLTPEEIEWINAYHADCRKALAPYLSEQEMEWLKKATEPI 596 >ref|XP_008795630.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Phoenix dactylifera] Length = 658 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQKKLMD +LLT EE++W+NAYHA CRK LAPY+ E EM WL +ATEPI Sbjct: 606 YQKKLMDLTLLTPEEIEWINAYHADCRKALAPYLSEQEMEWLKKATEPI 654 >ref|XP_010943163.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Elaeis guineensis] Length = 658 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQKKLMD +LL EE++WVN+YHA CRKVLAPY++E EM WL +ATEPI Sbjct: 606 YQKKLMDLTLLMPEEIEWVNSYHAECRKVLAPYLNEQEMEWLKKATEPI 654 >ref|XP_010943162.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Elaeis guineensis] Length = 685 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQKKLMD +LL EE++WVN+YHA CRKVLAPY++E EM WL +ATEPI Sbjct: 633 YQKKLMDLTLLMPEEIEWVNSYHAECRKVLAPYLNEQEMEWLKKATEPI 681 >ref|XP_010254935.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nelumbo nucifera] gi|719996947|ref|XP_010254936.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nelumbo nucifera] Length = 657 Score = 80.1 bits (196), Expect = 5e-13 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQKKLMD +L EE++WVN YHA CR++LAP++DE EMAWL +ATEPIS Sbjct: 607 YQKKLMDLRVLAPEEIEWVNTYHARCRELLAPFLDESEMAWLKKATEPIS 656 >ref|XP_010029829.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Eucalyptus grandis] Length = 642 Score = 78.2 bits (191), Expect = 2e-12 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQ KL++ SLLTTEE+ W+NAYH+ CR +LAPY+D+ EMAWL +ATEP+ Sbjct: 592 YQTKLINLSLLTTEEIDWLNAYHSKCRDILAPYLDDAEMAWLKKATEPV 640 >gb|KCW56801.1| hypothetical protein EUGRSUZ_I02469 [Eucalyptus grandis] Length = 663 Score = 78.2 bits (191), Expect = 2e-12 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQ KL++ SLLTTEE+ W+NAYH+ CR +LAPY+D+ EMAWL +ATEP+ Sbjct: 613 YQTKLINLSLLTTEEIDWLNAYHSKCRDILAPYLDDAEMAWLKKATEPV 661 >ref|XP_008338160.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Malus domestica] Length = 645 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQ+KL+D SLL EE++W+N YHA C+ +LAPY+DE E AWL RATEPIS Sbjct: 595 YQRKLIDLSLLVPEELEWLNTYHAKCKDILAPYLDESEKAWLKRATEPIS 644 >ref|XP_008241633.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Prunus mume] Length = 642 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQ+KL+D SLL EE++W+N YH+ CR +LAPYVDE E AWL +ATEPIS Sbjct: 592 YQRKLIDLSLLAPEELEWLNTYHSKCRDILAPYVDESEKAWLKKATEPIS 641 >ref|XP_007204612.1| hypothetical protein PRUPE_ppa002705mg [Prunus persica] gi|462400143|gb|EMJ05811.1| hypothetical protein PRUPE_ppa002705mg [Prunus persica] Length = 642 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQ+KL+D SLL EE++W+N YH+ CR +LAPYVDE E AWL +ATEPIS Sbjct: 592 YQRKLIDLSLLAPEELEWLNTYHSKCRDILAPYVDESEKAWLKKATEPIS 641 >ref|XP_011099591.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Sesamum indicum] Length = 645 Score = 76.6 bits (187), Expect = 6e-12 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQKKLMD SLL EE++W+N YH+ CR++LAPY++ EM WL +ATEPIS Sbjct: 595 YQKKLMDVSLLVPEEIEWLNNYHSKCREILAPYLNASEMEWLKKATEPIS 644 >gb|KHN36146.1| Putative Xaa-Pro aminopeptidase P [Glycine soja] Length = 932 Score = 76.3 bits (186), Expect = 8e-12 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQ KL+D +LL+ EE+ W+N+YHATCR +LAPY+DE E AWL +ATEP++ Sbjct: 702 YQTKLIDLNLLSPEEINWLNSYHATCRNILAPYLDEVENAWLKKATEPVA 751 >ref|XP_009414759.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Musa acuminata subsp. malaccensis] Length = 658 Score = 76.3 bits (186), Expect = 8e-12 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQKKLMD +LLT EE++W+N YH+ CR+VLAPY++E E WL ++TEPI Sbjct: 606 YQKKLMDLTLLTPEEIEWINLYHSDCREVLAPYMNEQETEWLKKSTEPI 654 >ref|XP_009414758.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Musa acuminata subsp. malaccensis] Length = 661 Score = 76.3 bits (186), Expect = 8e-12 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQKKLMD +LLT EE++W+N YH+ CR+VLAPY++E E WL ++TEPI Sbjct: 609 YQKKLMDLTLLTPEEIEWINLYHSDCREVLAPYMNEQETEWLKKSTEPI 657 >ref|NP_001276265.1| probable Xaa-Pro aminopeptidase P-like [Glycine max] gi|346229123|gb|AEO21435.1| Xaa-Pro aminopeptidase 2 [Glycine max] Length = 657 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQ KL+D +LL+ EE+ W+N+YHATCR +LAPY+DE E AWL +ATEP+ Sbjct: 607 YQTKLIDLNLLSPEEINWLNSYHATCRNILAPYLDEVENAWLKKATEPV 655 >ref|XP_007047006.1| Aminopeptidase P1 isoform 1 [Theobroma cacao] gi|508699267|gb|EOX91163.1| Aminopeptidase P1 isoform 1 [Theobroma cacao] Length = 645 Score = 75.1 bits (183), Expect = 2e-11 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPIS 290 YQ KL+D SLLT +E++WVN+YH+ CR++L PY+++H+M WL ATEP+S Sbjct: 595 YQIKLIDLSLLTPQEIEWVNSYHSKCREILEPYMEKHQMEWLKNATEPVS 644 >ref|XP_010667693.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Beta vulgaris subsp. vulgaris] gi|870841463|gb|KMS95197.1| hypothetical protein BVRB_011370 [Beta vulgaris subsp. vulgaris] Length = 653 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -1 Query: 439 YQKKLMDPSLLTTEEVQWVNAYHATCRKVLAPYVDEHEMAWLSRATEPI 293 YQ KL+D LLT EE+ WVN YH+ CR++L+PY++E EMAWL +ATEPI Sbjct: 599 YQHKLIDLKLLTPEEISWVNTYHSRCREILSPYMNETEMAWLRKATEPI 647