BLASTX nr result
ID: Cinnamomum25_contig00019932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00019932 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010419398.1| PREDICTED: coatomer subunit beta'-1-like [Ca... 66 8e-09 ref|XP_009388665.1| PREDICTED: coatomer subunit beta'-1 isoform ... 66 8e-09 ref|XP_009388663.1| PREDICTED: coatomer subunit beta'-1 isoform ... 66 8e-09 ref|XP_008644133.1| PREDICTED: uncharacterized protein LOC100383... 66 8e-09 gb|AGT17188.1| Coatomer beta' subunit [Saccharum hybrid cultivar... 66 8e-09 gb|EEE56543.1| hypothetical protein OsJ_05852 [Oryza sativa Japo... 66 8e-09 ref|XP_006647066.1| PREDICTED: coatomer subunit beta'-2-like iso... 66 8e-09 ref|XP_006647065.1| PREDICTED: coatomer subunit beta'-2-like iso... 66 8e-09 ref|XP_006647064.1| PREDICTED: coatomer subunit beta'-2-like iso... 66 8e-09 ref|XP_006647063.1| PREDICTED: coatomer subunit beta'-2-like iso... 66 8e-09 ref|XP_004951485.1| PREDICTED: coatomer subunit beta'-2-like [Se... 66 8e-09 sp|Q6H8D5.1|COB22_ORYSJ RecName: Full=Coatomer subunit beta'-2; ... 66 8e-09 gb|AFW71355.1| putative coatomer beta subunit family protein iso... 66 8e-09 ref|XP_008644132.1| PREDICTED: uncharacterized protein LOC100383... 66 8e-09 gb|AFW66087.1| putative coatomer beta subunit family protein [Ze... 66 8e-09 gb|AFW66084.1| putative coatomer beta subunit family protein iso... 66 8e-09 ref|XP_008679859.1| PREDICTED: coatomer subunit beta'-2-like [Ze... 66 8e-09 gb|AFW66082.1| putative coatomer beta subunit family protein [Ze... 66 8e-09 ref|XP_002453525.1| hypothetical protein SORBIDRAFT_04g007330 [S... 66 8e-09 ref|XP_010088850.1| Coatomer subunit beta'-2 [Morus notabilis] g... 65 1e-08 >ref|XP_010419398.1| PREDICTED: coatomer subunit beta'-1-like [Camelina sativa] Length = 1144 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 113 SVSVEKMPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 S + KMPLRL+IKRK AQRSERVKSVDLHPTEPWIL Sbjct: 210 SFGLAKMPLRLEIKRKFAQRSERVKSVDLHPTEPWIL 246 >ref|XP_009388665.1| PREDICTED: coatomer subunit beta'-1 isoform X2 [Musa acuminata subsp. malaccensis] gi|695004511|ref|XP_009388666.1| PREDICTED: coatomer subunit beta'-1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 899 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_009388663.1| PREDICTED: coatomer subunit beta'-1 isoform X1 [Musa acuminata subsp. malaccensis] gi|695004507|ref|XP_009388664.1| PREDICTED: coatomer subunit beta'-1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 904 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_008644133.1| PREDICTED: uncharacterized protein LOC100383977 isoform X2 [Zea mays] Length = 788 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >gb|AGT17188.1| Coatomer beta' subunit [Saccharum hybrid cultivar R570] Length = 924 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >gb|EEE56543.1| hypothetical protein OsJ_05852 [Oryza sativa Japonica Group] Length = 907 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_006647066.1| PREDICTED: coatomer subunit beta'-2-like isoform X4 [Oryza brachyantha] Length = 905 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_006647065.1| PREDICTED: coatomer subunit beta'-2-like isoform X3 [Oryza brachyantha] Length = 906 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_006647064.1| PREDICTED: coatomer subunit beta'-2-like isoform X2 [Oryza brachyantha] Length = 908 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_006647063.1| PREDICTED: coatomer subunit beta'-2-like isoform X1 [Oryza brachyantha] Length = 908 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_004951485.1| PREDICTED: coatomer subunit beta'-2-like [Setaria italica] Length = 921 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >sp|Q6H8D5.1|COB22_ORYSJ RecName: Full=Coatomer subunit beta'-2; AltName: Full=Beta'-coat protein 2; Short=Beta'-COP 2 gi|49387914|dbj|BAD25014.1| putative coatomer protein complex, subunit beta 2 (beta prime) [Oryza sativa Japonica Group] Length = 910 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >gb|AFW71355.1| putative coatomer beta subunit family protein isoform 1 [Zea mays] gi|413936805|gb|AFW71356.1| putative coatomer beta subunit family protein isoform 2 [Zea mays] gi|413936806|gb|AFW71357.1| putative coatomer beta subunit family protein isoform 3 [Zea mays] Length = 924 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_008644132.1| PREDICTED: uncharacterized protein LOC100383977 isoform X1 [Zea mays] gi|413936803|gb|AFW71354.1| putative coatomer beta subunit family protein [Zea mays] Length = 921 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >gb|AFW66087.1| putative coatomer beta subunit family protein [Zea mays] Length = 626 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >gb|AFW66084.1| putative coatomer beta subunit family protein isoform 1 [Zea mays] gi|413926153|gb|AFW66085.1| putative coatomer beta subunit family protein isoform 2 [Zea mays] gi|413926154|gb|AFW66086.1| putative coatomer beta subunit family protein isoform 3 [Zea mays] Length = 923 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_008679859.1| PREDICTED: coatomer subunit beta'-2-like [Zea mays] gi|413926151|gb|AFW66083.1| putative coatomer beta subunit family protein [Zea mays] Length = 919 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >gb|AFW66082.1| putative coatomer beta subunit family protein [Zea mays] Length = 825 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_002453525.1| hypothetical protein SORBIDRAFT_04g007330 [Sorghum bicolor] gi|241933356|gb|EES06501.1| hypothetical protein SORBIDRAFT_04g007330 [Sorghum bicolor] Length = 849 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL Sbjct: 1 MPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 31 >ref|XP_010088850.1| Coatomer subunit beta'-2 [Morus notabilis] gi|587846577|gb|EXB37047.1| Coatomer subunit beta'-2 [Morus notabilis] Length = 1023 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 98 KMPLRLDIKRKLAQRSERVKSVDLHPTEPWIL 3 KMPLRLDIKRK AQR+ERVKSVDLHPTEPWIL Sbjct: 70 KMPLRLDIKRKFAQRTERVKSVDLHPTEPWIL 101