BLASTX nr result
ID: Cinnamomum25_contig00019823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00019823 (395 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN12572.1| hypothetical protein AMTR_s00025p00213610 [Ambore... 57 6e-06 >gb|ERN12572.1| hypothetical protein AMTR_s00025p00213610 [Amborella trichopoda] Length = 148 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -1 Query: 167 YYMTYMRKKPRRTSSVSGATYVKEVLQGHHPTRCREVCRMELSVFRKLCDI 15 Y Y+ K P R SS+SG Y++EVL+GH RC +VCRMEL+VF+ C+I Sbjct: 25 YNDIYVNKIPLRNSSLSGYVYMEEVLKGHRE-RCLQVCRMELNVFQNFCEI 74