BLASTX nr result
ID: Cinnamomum25_contig00019588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00019588 (376 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520117.1| Protein kinase APK1A, chloroplast precursor,... 88 9e-17 ref|XP_010258573.1| PREDICTED: protein kinase 2B, chloroplastic-... 91 2e-16 ref|XP_010258572.1| PREDICTED: protein kinase 2B, chloroplastic-... 91 2e-16 ref|XP_011025834.1| PREDICTED: protein kinase 2B, chloroplastic-... 83 5e-16 ref|XP_011025841.1| PREDICTED: protein kinase 2B, chloroplastic-... 83 5e-16 ref|XP_002311595.1| KINASE 2B family protein [Populus trichocarp... 82 5e-16 ref|XP_002315799.1| KINASE 2B family protein [Populus trichocarp... 80 2e-15 ref|XP_009360375.1| PREDICTED: protein kinase 2B, chloroplastic-... 87 4e-15 ref|XP_008780759.1| PREDICTED: protein kinase 2B, chloroplastic-... 87 4e-15 ref|XP_010926227.1| PREDICTED: protein kinase 2B, chloroplastic-... 87 6e-15 ref|XP_012091915.1| PREDICTED: protein kinase 2B, chloroplastic ... 86 7e-15 ref|XP_007046178.1| Kinase 2B isoform 1 [Theobroma cacao] gi|590... 86 1e-14 ref|XP_011021612.1| PREDICTED: protein kinase 2B, chloroplastic-... 77 1e-14 ref|XP_011021613.1| PREDICTED: protein kinase 2B, chloroplastic-... 77 1e-14 ref|XP_008389509.1| PREDICTED: protein kinase 2B, chloroplastic ... 85 2e-14 ref|XP_012847712.1| PREDICTED: protein kinase 2B, chloroplastic-... 85 2e-14 ref|XP_003517946.2| PREDICTED: protein kinase 2B, chloroplastic-... 85 2e-14 ref|XP_004297326.1| PREDICTED: protein kinase 2B, chloroplastic-... 85 2e-14 ref|XP_008339927.1| PREDICTED: protein kinase 2B, chloroplastic-... 84 3e-14 ref|XP_003519043.2| PREDICTED: protein kinase 2B, chloroplastic-... 84 4e-14 >ref|XP_002520117.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus communis] gi|223540609|gb|EEF42172.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus communis] Length = 419 Score = 87.8 bits (216), Expect(2) = 9e-17 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYSE+S++E LPTPRTEGEILSSP+LK F FN+LKNATRNF Sbjct: 25 SRISSRTSRSSVPSSLTIPSYSERSSSECLPTPRTEGEILSSPNLKAFCFNELKNATRNF 84 Score = 25.4 bits (54), Expect(2) = 9e-17 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +S+ +VD Q S Sbjct: 1 MGNCLDSSAAKVDTTQGS 18 >ref|XP_010258573.1| PREDICTED: protein kinase 2B, chloroplastic-like isoform X2 [Nelumbo nucifera] Length = 415 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/60 (73%), Positives = 50/60 (83%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 SK + K+GL S PSNLT SYS+KS ESLPTPR+EGEILSSP+LK FSF +LKNATRNF Sbjct: 23 SKVTGKTGLSSAPSNLTFPSYSQKSTTESLPTPRSEGEILSSPNLKAFSFTELKNATRNF 82 >ref|XP_010258572.1| PREDICTED: protein kinase 2B, chloroplastic-like isoform X1 [Nelumbo nucifera] Length = 416 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/60 (73%), Positives = 50/60 (83%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 SK + K+GL S PSNLT SYS+KS ESLPTPR+EGEILSSP+LK FSF +LKNATRNF Sbjct: 24 SKVTGKTGLSSAPSNLTFPSYSQKSTTESLPTPRSEGEILSSPNLKAFSFTELKNATRNF 83 >ref|XP_011025834.1| PREDICTED: protein kinase 2B, chloroplastic-like isoform X1 [Populus euphratica] Length = 427 Score = 83.2 bits (204), Expect(2) = 5e-16 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYS KS++E PTPR+EGEILSSP+LK FSFN+LK+ATRNF Sbjct: 26 SRISSRTSRSSVPSSLTIPSYSGKSSSECFPTPRSEGEILSSPNLKAFSFNELKSATRNF 85 Score = 27.3 bits (59), Expect(2) = 5e-16 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +S+ +VD QSS Sbjct: 1 MGNCLDSSAAKVDSTQSS 18 >ref|XP_011025841.1| PREDICTED: protein kinase 2B, chloroplastic-like isoform X2 [Populus euphratica] Length = 425 Score = 83.2 bits (204), Expect(2) = 5e-16 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYS KS++E PTPR+EGEILSSP+LK FSFN+LK+ATRNF Sbjct: 24 SRISSRTSRSSVPSSLTIPSYSGKSSSECFPTPRSEGEILSSPNLKAFSFNELKSATRNF 83 Score = 27.3 bits (59), Expect(2) = 5e-16 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +S+ +VD QSS Sbjct: 1 MGNCLDSSAAKVDSTQSS 18 >ref|XP_002311595.1| KINASE 2B family protein [Populus trichocarpa] gi|222851415|gb|EEE88962.1| KINASE 2B family protein [Populus trichocarpa] Length = 418 Score = 82.0 bits (201), Expect(2) = 5e-16 Identities = 39/60 (65%), Positives = 51/60 (85%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYS KS+++ PTPR+EGEILSSP+LK FSFN+LK+ATRNF Sbjct: 24 SRISSRTSRSSVPSSLTIPSYSGKSSSDCFPTPRSEGEILSSPNLKAFSFNELKSATRNF 83 Score = 28.5 bits (62), Expect(2) = 5e-16 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +S+ RVD QSS Sbjct: 1 MGNCLDSSAARVDSTQSS 18 >ref|XP_002315799.1| KINASE 2B family protein [Populus trichocarpa] gi|222864839|gb|EEF01970.1| KINASE 2B family protein [Populus trichocarpa] Length = 417 Score = 80.1 bits (196), Expect(2) = 2e-15 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYS +S+ E LPTPR+EGEILSSP+LK FSFN+LKNATRNF Sbjct: 24 SRISSRTSHSSVPSSLTIPSYSGRSS-ECLPTPRSEGEILSSPNLKAFSFNELKNATRNF 82 Score = 28.5 bits (62), Expect(2) = 2e-15 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +SS +VD QSS Sbjct: 1 MGNCLDSSSAKVDSTQSS 18 >ref|XP_009360375.1| PREDICTED: protein kinase 2B, chloroplastic-like [Pyrus x bretschneideri] Length = 419 Score = 87.0 bits (214), Expect = 4e-15 Identities = 44/60 (73%), Positives = 49/60 (81%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 SK SSK+ SVPS LT+ SYS +S SLPTPRTEGEILSSP+LKPFSFN+LK ATRNF Sbjct: 26 SKVSSKTNPSSVPSTLTVPSYSGRSNASSLPTPRTEGEILSSPNLKPFSFNELKTATRNF 85 >ref|XP_008780759.1| PREDICTED: protein kinase 2B, chloroplastic-like [Phoenix dactylifera] Length = 429 Score = 87.0 bits (214), Expect = 4e-15 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 9/70 (12%) Frame = +1 Query: 193 PSKASSKSGLPSVPSNL---------TLKSYSEKSANESLPTPRTEGEILSSPHLKPFSF 345 PSK +SK+ L SVPS L T+ SY+E+++NESLPTPRTEGEILSS +LK F+F Sbjct: 24 PSKGTSKTNLSSVPSTLRTYSTPSTLTMPSYTERTSNESLPTPRTEGEILSSSNLKAFTF 83 Query: 346 NDLKNATRNF 375 NDLKNATRNF Sbjct: 84 NDLKNATRNF 93 >ref|XP_010926227.1| PREDICTED: protein kinase 2B, chloroplastic-like [Elaeis guineensis] Length = 428 Score = 86.7 bits (213), Expect = 6e-15 Identities = 46/70 (65%), Positives = 53/70 (75%), Gaps = 9/70 (12%) Frame = +1 Query: 193 PSKASSKSGLPSVPSNL---------TLKSYSEKSANESLPTPRTEGEILSSPHLKPFSF 345 PSK +SK+ L SVPS L T+ SYSE++A+ESLPTPRTEGEILSS +LK F F Sbjct: 23 PSKGTSKTNLSSVPSTLPTSSTPSTLTVSSYSERTASESLPTPRTEGEILSSSNLKAFPF 82 Query: 346 NDLKNATRNF 375 NDLKNATRNF Sbjct: 83 NDLKNATRNF 92 >ref|XP_012091915.1| PREDICTED: protein kinase 2B, chloroplastic [Jatropha curcas] gi|643704145|gb|KDP21209.1| hypothetical protein JCGZ_21680 [Jatropha curcas] Length = 395 Score = 86.3 bits (212), Expect = 7e-15 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SSK+ SVPS+LT+ S E+S ++ LPTPRTEGEILSSP+LKPFSFN+L+NATRNF Sbjct: 6 SRISSKTSRSSVPSSLTIPSSGERSTSDCLPTPRTEGEILSSPNLKPFSFNELRNATRNF 65 >ref|XP_007046178.1| Kinase 2B isoform 1 [Theobroma cacao] gi|590700502|ref|XP_007046179.1| Kinase 2B isoform 1 [Theobroma cacao] gi|508710113|gb|EOY02010.1| Kinase 2B isoform 1 [Theobroma cacao] gi|508710114|gb|EOY02011.1| Kinase 2B isoform 1 [Theobroma cacao] Length = 420 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SSK+ S PS+LT+ S+S+ S++ LPTPRTEGEILSSP+LKPFSFN+LKNATRNF Sbjct: 26 SRISSKTSRSSAPSSLTIPSFSDTSSSGCLPTPRTEGEILSSPNLKPFSFNELKNATRNF 85 >ref|XP_011021612.1| PREDICTED: protein kinase 2B, chloroplastic-like isoform X1 [Populus euphratica] Length = 480 Score = 77.4 bits (189), Expect(2) = 1e-14 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYS +S E LPTPR+EGEILSSP+LK FS N+LKNATRNF Sbjct: 87 SRISSRTSHSSVPSSLTIPSYSGRSG-ECLPTPRSEGEILSSPNLKAFSLNELKNATRNF 145 Score = 28.5 bits (62), Expect(2) = 1e-14 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +SS +VD QSS Sbjct: 64 MGNCLDSSSAKVDSTQSS 81 >ref|XP_011021613.1| PREDICTED: protein kinase 2B, chloroplastic-like isoform X2 [Populus euphratica] Length = 417 Score = 77.4 bits (189), Expect(2) = 1e-14 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 S+ SS++ SVPS+LT+ SYS +S E LPTPR+EGEILSSP+LK FS N+LKNATRNF Sbjct: 24 SRISSRTSHSSVPSSLTIPSYSGRSG-ECLPTPRSEGEILSSPNLKAFSLNELKNATRNF 82 Score = 28.5 bits (62), Expect(2) = 1e-14 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 105 MGNCLHASSTRVDHAQSS 158 MGNCL +SS +VD QSS Sbjct: 1 MGNCLDSSSAKVDSTQSS 18 >ref|XP_008389509.1| PREDICTED: protein kinase 2B, chloroplastic [Malus domestica] Length = 419 Score = 85.1 bits (209), Expect = 2e-14 Identities = 43/60 (71%), Positives = 48/60 (80%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 SK SSK+ SVPS LT+ SYS +S SLPTPRTEGEILS P+LKPFSFN+LK ATRNF Sbjct: 26 SKVSSKTNPSSVPSTLTVPSYSGRSNASSLPTPRTEGEILSCPNLKPFSFNELKTATRNF 85 >ref|XP_012847712.1| PREDICTED: protein kinase 2B, chloroplastic-like [Erythranthe guttatus] gi|604316530|gb|EYU28722.1| hypothetical protein MIMGU_mgv1a007163mg [Erythranthe guttata] Length = 417 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +1 Query: 190 EPSKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATR 369 E SK SK+ S PSN+++ SYS KS+ ESLPTPR+E EILSSP++KPF+FN+LKNATR Sbjct: 20 EGSKCPSKTSNSSHPSNISIPSYSNKSSAESLPTPRSEAEILSSPNVKPFAFNELKNATR 79 Query: 370 NF 375 NF Sbjct: 80 NF 81 >ref|XP_003517946.2| PREDICTED: protein kinase 2B, chloroplastic-like [Glycine max] gi|734313088|gb|KHN01188.1| Protein kinase 2B, chloroplastic [Glycine soja] Length = 411 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/63 (66%), Positives = 54/63 (85%), Gaps = 1/63 (1%) Frame = +1 Query: 190 EPSKASSKSGLP-SVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNAT 366 + SK++S SG+ + PS+L++ SYSEKS SLPTPR+EGEILSSP+LKPF+FN+LKNAT Sbjct: 15 QSSKSTSASGISKTTPSSLSIPSYSEKSNASSLPTPRSEGEILSSPNLKPFTFNELKNAT 74 Query: 367 RNF 375 RNF Sbjct: 75 RNF 77 >ref|XP_004297326.1| PREDICTED: protein kinase 2B, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 421 Score = 84.7 bits (208), Expect = 2e-14 Identities = 43/61 (70%), Positives = 51/61 (83%), Gaps = 1/61 (1%) Frame = +1 Query: 196 SKASSKSGLPSV-PSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRN 372 SK+SSK+ S P +LT+ SYSEKS + SLPTPRTEGEILSSP+L PFSFN+L+NATRN Sbjct: 26 SKSSSKTSPSSAAPPSLTISSYSEKSNSSSLPTPRTEGEILSSPNLNPFSFNELRNATRN 85 Query: 373 F 375 F Sbjct: 86 F 86 >ref|XP_008339927.1| PREDICTED: protein kinase 2B, chloroplastic-like [Malus domestica] Length = 419 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/60 (68%), Positives = 49/60 (81%) Frame = +1 Query: 196 SKASSKSGLPSVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNATRNF 375 SK S+K+ S PS LT+ SY+ +S+ SLPTPRTEGEILSSP+LK FSFN+LKNATRNF Sbjct: 26 SKVSNKTSPSSAPSTLTVPSYNGRSSGSSLPTPRTEGEILSSPNLKAFSFNELKNATRNF 85 >ref|XP_003519043.2| PREDICTED: protein kinase 2B, chloroplastic-like [Glycine max] gi|734338080|gb|KHN08695.1| Protein kinase 2B, chloroplastic [Glycine soja] Length = 411 Score = 84.0 bits (206), Expect = 4e-14 Identities = 41/63 (65%), Positives = 54/63 (85%), Gaps = 1/63 (1%) Frame = +1 Query: 190 EPSKASSKSGLP-SVPSNLTLKSYSEKSANESLPTPRTEGEILSSPHLKPFSFNDLKNAT 366 + S+++S SG+ + PS+L++ SYSEKS SLPTPR+EGEILSSP+LKPF+FN+LKNAT Sbjct: 15 QSSRSTSASGISKTTPSSLSIPSYSEKSNASSLPTPRSEGEILSSPNLKPFTFNELKNAT 74 Query: 367 RNF 375 RNF Sbjct: 75 RNF 77