BLASTX nr result
ID: Cinnamomum25_contig00019532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00019532 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010059639.1| PREDICTED: uncharacterized protein LOC104447... 59 2e-06 ref|XP_007203877.1| hypothetical protein PRUPE_ppa005088mg [Prun... 57 6e-06 ref|XP_007027792.1| GATA zinc finger domain-containing protein C... 56 8e-06 ref|XP_007027791.1| GATA zinc finger domain-containing protein C... 56 8e-06 >ref|XP_010059639.1| PREDICTED: uncharacterized protein LOC104447615 [Eucalyptus grandis] gi|629126110|gb|KCW90535.1| hypothetical protein EUGRSUZ_A02649 [Eucalyptus grandis] Length = 488 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +2 Query: 155 PMSEPRARPLGGTEYSWCRAVPGGTGITV 241 P SEP RP+GGTEYSWCRAVPGGTGITV Sbjct: 12 PPSEPVTRPVGGTEYSWCRAVPGGTGITV 40 >ref|XP_007203877.1| hypothetical protein PRUPE_ppa005088mg [Prunus persica] gi|462399408|gb|EMJ05076.1| hypothetical protein PRUPE_ppa005088mg [Prunus persica] Length = 477 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 152 EPMSEPRARPLGGTEYSWCRAVPGGTGITV 241 E M EP+ RP+GGTEYSWC+AVP GTGITV Sbjct: 12 EAMPEPKTRPVGGTEYSWCKAVPSGTGITV 41 >ref|XP_007027792.1| GATA zinc finger domain-containing protein C1393.08 isoform 2 [Theobroma cacao] gi|508716397|gb|EOY08294.1| GATA zinc finger domain-containing protein C1393.08 isoform 2 [Theobroma cacao] Length = 481 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 164 EPRARPLGGTEYSWCRAVPGGTGITV 241 EP+ RP GGTEYSWCRAVPGGTGITV Sbjct: 14 EPKVRPAGGTEYSWCRAVPGGTGITV 39 >ref|XP_007027791.1| GATA zinc finger domain-containing protein C1393.08 isoform 1 [Theobroma cacao] gi|508716396|gb|EOY08293.1| GATA zinc finger domain-containing protein C1393.08 isoform 1 [Theobroma cacao] Length = 478 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 164 EPRARPLGGTEYSWCRAVPGGTGITV 241 EP+ RP GGTEYSWCRAVPGGTGITV Sbjct: 14 EPKVRPAGGTEYSWCRAVPGGTGITV 39