BLASTX nr result
ID: Cinnamomum25_contig00017456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00017456 (390 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containin... 87 3e-15 ref|XP_011653049.1| PREDICTED: katanin p80 WD40 repeat-containin... 82 1e-13 ref|XP_011653046.1| PREDICTED: katanin p80 WD40 repeat-containin... 82 1e-13 ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containin... 82 1e-13 ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containin... 82 1e-13 ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containin... 82 2e-13 ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Popu... 82 2e-13 ref|XP_012568557.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 ... 81 2e-13 gb|KEH36528.1| katanin p80 WD40 repeat subunit B1-like protein [... 81 3e-13 gb|AES63731.2| katanin p80 WD40 repeat subunit B1-like protein [... 81 3e-13 ref|XP_010057471.1| PREDICTED: katanin p80 WD40 repeat-containin... 80 7e-13 ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phas... 79 1e-12 gb|KMS96766.1| hypothetical protein BVRB_8g199500 isoform C [Bet... 79 2e-12 ref|XP_010696580.1| PREDICTED: katanin p80 WD40 repeat-containin... 79 2e-12 ref|XP_010696579.1| PREDICTED: katanin p80 WD40 repeat-containin... 79 2e-12 ref|XP_010696578.1| PREDICTED: katanin p80 WD40 repeat-containin... 79 2e-12 ref|XP_012091536.1| PREDICTED: katanin p80 WD40 repeat-containin... 78 2e-12 ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containin... 78 2e-12 ref|XP_012091535.1| PREDICTED: katanin p80 WD40 repeat-containin... 78 2e-12 emb|CBI38493.3| unnamed protein product [Vitis vinifera] 78 2e-12 >ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Nelumbo nucifera] Length = 786 Score = 87.4 bits (215), Expect = 3e-15 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AHAS+V C+ IGKKSC L VTGGEDHRVNLWA GK NSLL L Sbjct: 1 MAKRGYKLQEFVAHASSVNCLSIGKKSCRLLVTGGEDHRVNLWAIGKPNSLLSL 54 >ref|XP_011653049.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Cucumis sativus] Length = 976 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ L Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSL 54 >ref|XP_011653046.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cucumis sativus] gi|700209542|gb|KGN64638.1| hypothetical protein Csa_1G072490 [Cucumis sativus] Length = 978 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ L Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSL 54 >ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Cucumis melo] Length = 920 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ L Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSL 54 >ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cucumis melo] Length = 922 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ L Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSL 54 >ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Populus euphratica] Length = 959 Score = 81.6 bits (200), Expect = 2e-13 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C+ IGKK+C +F+TGG+DH+VNLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRMFITGGDDHKVNLWAIGKPTSLMSL 54 >ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] gi|550327580|gb|ERP55104.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] Length = 990 Score = 81.6 bits (200), Expect = 2e-13 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C+ IGKK+C +F+TGG+DH+VNLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRMFITGGDDHKVNLWAIGKPTSLMSL 54 >ref|XP_012568557.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 WD40 repeat-containing subunit B1 homolog [Cicer arietinum] Length = 1121 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+SNV C+ IGKK+C LFVTGG+DH+VNLW GK SL L Sbjct: 1 MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSLTSL 54 >gb|KEH36528.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] Length = 1030 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+SNV C+ IGKK+C LFVTGG+DH+VNLW GK SL L Sbjct: 1 MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSLSSL 54 >gb|AES63731.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] Length = 1111 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+SNV C+ IGKK+C LFVTGG+DH+VNLW GK SL L Sbjct: 1 MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSLSSL 54 >ref|XP_010057471.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Eucalyptus grandis] gi|629109497|gb|KCW74643.1| hypothetical protein EUGRSUZ_E03367 [Eucalyptus grandis] Length = 1017 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 M+KRGYK E AH+SNV C+ IGKK+C LF+TGG+D +VNLWA GK NSL+ L Sbjct: 1 MSKRGYKLQEFVAHSSNVNCLSIGKKACRLFLTGGDDCKVNLWAIGKPNSLMSL 54 >ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] gi|561021439|gb|ESW20210.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] Length = 828 Score = 79.0 bits (193), Expect = 1e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH+++V C+ IGKK+C LF+TGG+DH+VNLW GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSASVNCLNIGKKACRLFITGGDDHKVNLWTIGKPTSLMSL 54 >gb|KMS96766.1| hypothetical protein BVRB_8g199500 isoform C [Beta vulgaris subsp. vulgaris] Length = 819 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSL 54 >ref|XP_010696580.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Beta vulgaris subsp. vulgaris] Length = 820 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSL 54 >ref|XP_010696579.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Beta vulgaris subsp. vulgaris] gi|870843624|gb|KMS96764.1| hypothetical protein BVRB_8g199500 isoform A [Beta vulgaris subsp. vulgaris] Length = 820 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSL 54 >ref|XP_010696578.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Beta vulgaris subsp. vulgaris] gi|870843625|gb|KMS96765.1| hypothetical protein BVRB_8g199500 isoform B [Beta vulgaris subsp. vulgaris] Length = 821 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSL 54 >ref|XP_012091536.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Jatropha curcas] Length = 936 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C+ IGKK+C LF+TGG+D++VNLW GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRLFITGGDDNKVNLWTIGKPTSLMSL 54 >ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Vitis vinifera] Length = 806 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH +NV C+ IGKK+C L ++GG+DH+VNLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHTTNVNCLNIGKKACRLLISGGDDHKVNLWAIGKPTSLMSL 54 >ref|XP_012091535.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Jatropha curcas] gi|643703848|gb|KDP20912.1| hypothetical protein JCGZ_21383 [Jatropha curcas] Length = 941 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH++NV C+ IGKK+C LF+TGG+D++VNLW GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRLFITGGDDNKVNLWTIGKPTSLMSL 54 >emb|CBI38493.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -1 Query: 177 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLLEL 16 MAKRGYK E AH +NV C+ IGKK+C L ++GG+DH+VNLWA GK SL+ L Sbjct: 1 MAKRGYKLQEFVAHTTNVNCLNIGKKACRLLISGGDDHKVNLWAIGKPTSLMSL 54