BLASTX nr result
ID: Cinnamomum25_contig00016915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00016915 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN41593.1| Putative transporter arsB [Glycine soja] 93 6e-17 gb|KHN09314.1| Putative transporter arsB [Glycine soja] 93 6e-17 ref|XP_004512819.1| PREDICTED: putative transporter arsB [Cicer ... 93 6e-17 ref|XP_003533988.1| PREDICTED: putative transporter arsB-like is... 93 6e-17 ref|XP_007038758.1| Divalent ion symporter isoform 4, partial [T... 92 1e-16 ref|XP_007038755.1| Divalent ion symporter isoform 1 [Theobroma ... 92 1e-16 ref|XP_003627812.1| Transporter, putative [Medicago truncatula] ... 92 1e-16 ref|XP_011076136.1| PREDICTED: putative transporter arsB [Sesamu... 92 2e-16 gb|KHN41594.1| Putative transporter arsB [Glycine soja] 92 2e-16 gb|KHN09315.1| Putative transporter arsB [Glycine soja] 92 2e-16 ref|XP_003548170.1| PREDICTED: putative transporter arsB-like [G... 92 2e-16 ref|XP_003533989.1| PREDICTED: putative transporter arsB-like [G... 92 2e-16 ref|XP_009397931.1| PREDICTED: putative transporter arsB [Musa a... 91 2e-16 ref|XP_008234200.1| PREDICTED: putative transporter arsB [Prunus... 91 2e-16 emb|CBI20921.3| unnamed protein product [Vitis vinifera] 91 2e-16 ref|XP_006363328.1| PREDICTED: putative transporter arsB-like [S... 91 2e-16 ref|XP_007152217.1| hypothetical protein PHAVU_004G111500g [Phas... 91 2e-16 ref|XP_007220313.1| hypothetical protein PRUPE_ppa024761mg [Prun... 91 2e-16 ref|XP_002284453.1| PREDICTED: putative transporter arsB [Vitis ... 91 2e-16 ref|XP_010660570.1| PREDICTED: putative transporter arsB [Vitis ... 91 3e-16 >gb|KHN41593.1| Putative transporter arsB [Glycine soja] Length = 538 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GS+AFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVISPDQAY Sbjct: 12 GSVAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVISPDQAY 58 >gb|KHN09314.1| Putative transporter arsB [Glycine soja] Length = 542 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GS+AFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVISPDQAY Sbjct: 12 GSVAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVISPDQAY 58 >ref|XP_004512819.1| PREDICTED: putative transporter arsB [Cicer arietinum] gi|502163374|ref|XP_004512820.1| PREDICTED: putative transporter arsB [Cicer arietinum] gi|502163377|ref|XP_004512821.1| PREDICTED: putative transporter arsB [Cicer arietinum] Length = 540 Score = 93.2 bits (230), Expect = 6e-17 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVISPDQAY Sbjct: 12 GSIAFAIFWILAVFPAVPFLPIGRTAGSLLGAMLMVIFRVISPDQAY 58 >ref|XP_003533988.1| PREDICTED: putative transporter arsB-like isoform X1 [Glycine max] gi|571477514|ref|XP_006587277.1| PREDICTED: putative transporter arsB-like isoform X2 [Glycine max] gi|571477516|ref|XP_006587278.1| PREDICTED: putative transporter arsB-like isoform X3 [Glycine max] gi|571477518|ref|XP_006587279.1| PREDICTED: putative transporter arsB-like isoform X4 [Glycine max] gi|571477520|ref|XP_006587280.1| PREDICTED: putative transporter arsB-like isoform X5 [Glycine max] gi|571477522|ref|XP_006587281.1| PREDICTED: putative transporter arsB-like isoform X6 [Glycine max] gi|571477524|ref|XP_006587282.1| PREDICTED: putative transporter arsB-like isoform X7 [Glycine max] gi|571477527|ref|XP_006587283.1| PREDICTED: putative transporter arsB-like isoform X8 [Glycine max] Length = 538 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GS+AFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVISPDQAY Sbjct: 12 GSVAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVISPDQAY 58 >ref|XP_007038758.1| Divalent ion symporter isoform 4, partial [Theobroma cacao] gi|508776003|gb|EOY23259.1| Divalent ion symporter isoform 4, partial [Theobroma cacao] Length = 429 Score = 92.0 bits (227), Expect = 1e-16 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLPVGRTAGSLLGAMLMV+FRVI+PDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPVGRTAGSLLGAMLMVLFRVITPDQAY 58 >ref|XP_007038755.1| Divalent ion symporter isoform 1 [Theobroma cacao] gi|590672957|ref|XP_007038756.1| Divalent ion symporter isoform 1 [Theobroma cacao] gi|508776000|gb|EOY23256.1| Divalent ion symporter isoform 1 [Theobroma cacao] gi|508776001|gb|EOY23257.1| Divalent ion symporter isoform 1 [Theobroma cacao] Length = 548 Score = 92.0 bits (227), Expect = 1e-16 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLPVGRTAGSLLGAMLMV+FRVI+PDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPVGRTAGSLLGAMLMVLFRVITPDQAY 58 >ref|XP_003627812.1| Transporter, putative [Medicago truncatula] gi|92885111|gb|ABE87631.1| transporter, putative [Medicago truncatula] gi|355521834|gb|AET02288.1| silicon efflux transporter [Medicago truncatula] Length = 544 Score = 92.0 bits (227), Expect = 1e-16 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVISPD+AY Sbjct: 12 GSIAFAIFWILAVFPAVPFLPIGRTAGSLLGAMLMVIFRVISPDEAY 58 >ref|XP_011076136.1| PREDICTED: putative transporter arsB [Sesamum indicum] Length = 564 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMV+FRVI+PDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVLFRVITPDQAY 58 >gb|KHN41594.1| Putative transporter arsB [Glycine soja] Length = 387 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIF+V+SPDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFKVLSPDQAY 58 >gb|KHN09315.1| Putative transporter arsB [Glycine soja] Length = 538 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIF+V+SPDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFKVLSPDQAY 58 >ref|XP_003548170.1| PREDICTED: putative transporter arsB-like [Glycine max] Length = 538 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIF+V+SPDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFKVLSPDQAY 58 >ref|XP_003533989.1| PREDICTED: putative transporter arsB-like [Glycine max] gi|734422392|gb|KHN41595.1| Putative transporter arsB [Glycine soja] Length = 523 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIF+V+SPDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFKVLSPDQAY 58 >ref|XP_009397931.1| PREDICTED: putative transporter arsB [Musa acuminata subsp. malaccensis] gi|695021670|ref|XP_009397932.1| PREDICTED: putative transporter arsB [Musa acuminata subsp. malaccensis] Length = 488 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLG MLM+IFRVISPDQAY Sbjct: 12 GSIAFAIFWMLAVFPAVPFLPIGRTAGSLLGGMLMIIFRVISPDQAY 58 >ref|XP_008234200.1| PREDICTED: putative transporter arsB [Prunus mume] gi|645256982|ref|XP_008234201.1| PREDICTED: putative transporter arsB [Prunus mume] gi|645256984|ref|XP_008234202.1| PREDICTED: putative transporter arsB [Prunus mume] gi|645256986|ref|XP_008234203.1| PREDICTED: putative transporter arsB [Prunus mume] Length = 547 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFA+FW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRV++PDQAY Sbjct: 12 GSIAFAVFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVLTPDQAY 58 >emb|CBI20921.3| unnamed protein product [Vitis vinifera] Length = 359 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVI+PD+AY Sbjct: 21 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVITPDEAY 67 >ref|XP_006363328.1| PREDICTED: putative transporter arsB-like [Solanum tuberosum] Length = 533 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFA+FW LAVFPAVPF+P+GRTAGSLLGAMLMVIFRVI+PDQAY Sbjct: 12 GSIAFAVFWVLAVFPAVPFMPIGRTAGSLLGAMLMVIFRVITPDQAY 58 >ref|XP_007152217.1| hypothetical protein PHAVU_004G111500g [Phaseolus vulgaris] gi|593703631|ref|XP_007152218.1| hypothetical protein PHAVU_004G111500g [Phaseolus vulgaris] gi|561025526|gb|ESW24211.1| hypothetical protein PHAVU_004G111500g [Phaseolus vulgaris] gi|561025527|gb|ESW24212.1| hypothetical protein PHAVU_004G111500g [Phaseolus vulgaris] Length = 540 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GS+AFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIF+VISPDQAY Sbjct: 12 GSVAFAIFWMLAVFPAVPFLPIGRTAGSLLGAMLMVIFQVISPDQAY 58 >ref|XP_007220313.1| hypothetical protein PRUPE_ppa024761mg [Prunus persica] gi|462416775|gb|EMJ21512.1| hypothetical protein PRUPE_ppa024761mg [Prunus persica] Length = 547 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFA+FW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRV++PDQAY Sbjct: 12 GSIAFAVFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVLTPDQAY 58 >ref|XP_002284453.1| PREDICTED: putative transporter arsB [Vitis vinifera] Length = 544 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGAMLMVIFRVI+PD+AY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAMLMVIFRVITPDEAY 58 >ref|XP_010660570.1| PREDICTED: putative transporter arsB [Vitis vinifera] Length = 559 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 GSIAFAIFWALAVFPAVPFLPVGRTAGSLLGAMLMVIFRVISPDQAY 3 GSIAFAIFW LAVFPAVPFLP+GRTAGSLLGA+LMVIFRVI+PDQAY Sbjct: 12 GSIAFAIFWVLAVFPAVPFLPIGRTAGSLLGAILMVIFRVITPDQAY 58