BLASTX nr result
ID: Cinnamomum25_contig00016555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00016555 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010252400.1| PREDICTED: pentatricopeptide repeat-containi... 185 9e-45 ref|XP_010911263.1| PREDICTED: pentatricopeptide repeat-containi... 182 7e-44 emb|CDP03394.1| unnamed protein product [Coffea canephora] 178 1e-42 ref|XP_008464984.1| PREDICTED: pentatricopeptide repeat-containi... 177 3e-42 ref|XP_010917697.1| PREDICTED: pentatricopeptide repeat-containi... 176 4e-42 gb|KGN65409.1| hypothetical protein Csa_1G418260 [Cucumis sativus] 176 7e-42 ref|XP_006351154.1| PREDICTED: pentatricopeptide repeat-containi... 174 3e-41 ref|XP_009766763.1| PREDICTED: pentatricopeptide repeat-containi... 172 6e-41 ref|XP_012078934.1| PREDICTED: pentatricopeptide repeat-containi... 172 8e-41 gb|KDP32344.1| hypothetical protein JCGZ_13269 [Jatropha curcas] 172 8e-41 ref|XP_004250591.1| PREDICTED: pentatricopeptide repeat-containi... 172 8e-41 emb|CBI28142.3| unnamed protein product [Vitis vinifera] 171 1e-40 ref|XP_002281719.2| PREDICTED: pentatricopeptide repeat-containi... 171 1e-40 ref|XP_009607091.1| PREDICTED: pentatricopeptide repeat-containi... 170 3e-40 ref|XP_010098972.1| hypothetical protein L484_025631 [Morus nota... 170 4e-40 ref|XP_002529360.1| pentatricopeptide repeat-containing protein,... 168 1e-39 ref|XP_007013319.1| Pentatricopeptide repeat-containing protein,... 167 2e-39 ref|XP_006385618.1| hypothetical protein POPTR_0003s08690g [Popu... 167 3e-39 ref|XP_012574775.1| PREDICTED: pentatricopeptide repeat-containi... 165 9e-39 ref|XP_012447935.1| PREDICTED: pentatricopeptide repeat-containi... 165 1e-38 >ref|XP_010252400.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] gi|719988637|ref|XP_010252401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] gi|719988640|ref|XP_010252402.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] Length = 661 Score = 185 bits (470), Expect = 9e-45 Identities = 85/106 (80%), Positives = 95/106 (89%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKSIE+F+ +EEKD ASWTAIICGLAMNGQT ALELFSEMK +G KPDDITF Sbjct: 409 YAKCGCIEKSIEIFKRIEEKDRASWTAIICGLAMNGQTTKALELFSEMKLVGVKPDDITF 468 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +FD M+++Y IEPK+EHYGC +DLLGRA Sbjct: 469 IGVLSACSHGGLVEEGRRHFDSMRKLYQIEPKLEHYGCFIDLLGRA 514 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 Y CG ++++ E+F +D WTA+I G Q AL LF EM+ KPD T Sbjct: 308 YVNCGQLDEARELFDRTPVRDVILWTAMINGYVQYNQFDKALTLFREMQMKRVKPDKFTL 367 Query: 140 IGVLSACSHGGLVEEG 93 + +L+ C+ G +E+G Sbjct: 368 VALLTGCAQLGALEQG 383 >ref|XP_010911263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like, partial [Elaeis guineensis] Length = 451 Score = 182 bits (462), Expect = 7e-44 Identities = 83/106 (78%), Positives = 95/106 (89%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCI+KS+++FR VE KDTA WT+IICGLA+NGQT ALELFSEMK IGT+PDDITF Sbjct: 195 YAKCGCIQKSLDIFRGVEGKDTAMWTSIICGLALNGQTSKALELFSEMKSIGTEPDDITF 254 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVL+ACSHGGLV+EG YFD MK ++ IEPK+EHYGCLVDLLGRA Sbjct: 255 IGVLNACSHGGLVDEGRKYFDAMKEVHQIEPKLEHYGCLVDLLGRA 300 >emb|CDP03394.1| unnamed protein product [Coffea canephora] Length = 641 Score = 178 bits (452), Expect = 1e-42 Identities = 81/106 (76%), Positives = 93/106 (87%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKS+ +F +++EKDTASWTA+IC LAMNG++ ALELFS MKQ G KPDDITF Sbjct: 419 YAKCGCIEKSLAIFNTLKEKDTASWTAVICALAMNGESFKALELFSGMKQAGIKPDDITF 478 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +FD MK +YHIEPK+EHYGCL+DL GRA Sbjct: 479 IGVLSACSHGGLVEEGRQHFDSMKNVYHIEPKLEHYGCLIDLFGRA 524 >ref|XP_008464984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130072|ref|XP_008464985.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130074|ref|XP_008464986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130076|ref|XP_008464987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130078|ref|XP_008464988.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130080|ref|XP_008464989.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130082|ref|XP_008464990.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130084|ref|XP_008464991.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130086|ref|XP_008464992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130088|ref|XP_008464993.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] gi|659130090|ref|XP_008464994.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cucumis melo] Length = 670 Score = 177 bits (448), Expect = 3e-42 Identities = 79/106 (74%), Positives = 95/106 (89%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 Y+KCGC++KS+E+F +E+KDTASWT+IICGLAMNG+T AL LFSEM+ +G KPDDITF Sbjct: 413 YSKCGCVDKSLEIFYELEDKDTASWTSIICGLAMNGKTSEALRLFSEMELVGAKPDDITF 472 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +F+ MK++Y IEPKVEHYGC+VDLLGRA Sbjct: 473 IGVLSACSHGGLVEEGRRFFNSMKKVYRIEPKVEHYGCVVDLLGRA 518 >ref|XP_010917697.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Elaeis guineensis] Length = 670 Score = 176 bits (447), Expect = 4e-42 Identities = 81/106 (76%), Positives = 93/106 (87%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCG I+KS+++FR VE KDTA WT+IICGLA+NGQT ALELFSEMK IG +PDDITF Sbjct: 414 YAKCGSIQKSLDIFRGVEGKDTAMWTSIICGLALNGQTSKALELFSEMKSIGAEPDDITF 473 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVL+ACSHGGLV+EG YFD MK ++ IEPK+EHYGCLVDLLGRA Sbjct: 474 IGVLNACSHGGLVDEGRKYFDAMKEVHQIEPKLEHYGCLVDLLGRA 519 >gb|KGN65409.1| hypothetical protein Csa_1G418260 [Cucumis sativus] Length = 811 Score = 176 bits (445), Expect = 7e-42 Identities = 77/106 (72%), Positives = 96/106 (90%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 Y+KCGC++KS+E+F +E+KDTASWT+IICGLAMNG+T AL LFSEM+++G KPDDITF Sbjct: 551 YSKCGCVDKSLEIFYELEDKDTASWTSIICGLAMNGKTSEALRLFSEMERVGAKPDDITF 610 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +F+ MK+++ IEPKVEHYGC++DLLGRA Sbjct: 611 IGVLSACSHGGLVEEGRRFFNSMKKVHRIEPKVEHYGCVIDLLGRA 656 >ref|XP_006351154.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Solanum tuberosum] Length = 604 Score = 174 bits (440), Expect = 3e-41 Identities = 81/106 (76%), Positives = 92/106 (86%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKS+E+F +EEKDTASWT+IIC LAM+G TR ALELFSEM+Q G PDDIT+ Sbjct: 390 YAKCGCIEKSMEIFDELEEKDTASWTSIICSLAMSGNTRKALELFSEMEQAGFHPDDITY 449 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG YF M RI+ I+PK+EHYGCL+DLLGRA Sbjct: 450 IGVLSACSHGGLVEEGRKYFHAMSRIHAIQPKLEHYGCLIDLLGRA 495 >ref|XP_009766763.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nicotiana sylvestris] Length = 624 Score = 172 bits (437), Expect = 6e-41 Identities = 81/106 (76%), Positives = 92/106 (86%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKS+E+F ++EKDTASWT+IIC LAM+G TR ALELFS+M+Q G PDDITF Sbjct: 411 YAKCGCIEKSMEIFDGLKEKDTASWTSIICALAMSGNTRKALELFSQMEQAGFCPDDITF 470 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG YF M RIY I+PK+EHYGCL+DLLGRA Sbjct: 471 IGVLSACSHGGLVEEGRRYFHSMSRIYGIQPKLEHYGCLIDLLGRA 516 >ref|XP_012078934.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Jatropha curcas] Length = 682 Score = 172 bits (436), Expect = 8e-41 Identities = 76/106 (71%), Positives = 95/106 (89%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEK++E+F + EKDTASWT+IICGLA+NG+TR +L+LFS+MKQ G +PDDITF Sbjct: 412 YAKCGCIEKALEIFYGLREKDTASWTSIICGLAVNGKTRMSLDLFSKMKQAGVRPDDITF 471 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IG+LSACSHGGLVEEG ++F+ M +Y I+PK+EHYGCL+DLLGRA Sbjct: 472 IGILSACSHGGLVEEGRNFFNSMTTMYQIKPKLEHYGCLIDLLGRA 517 >gb|KDP32344.1| hypothetical protein JCGZ_13269 [Jatropha curcas] Length = 610 Score = 172 bits (436), Expect = 8e-41 Identities = 76/106 (71%), Positives = 95/106 (89%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEK++E+F + EKDTASWT+IICGLA+NG+TR +L+LFS+MKQ G +PDDITF Sbjct: 340 YAKCGCIEKALEIFYGLREKDTASWTSIICGLAVNGKTRMSLDLFSKMKQAGVRPDDITF 399 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IG+LSACSHGGLVEEG ++F+ M +Y I+PK+EHYGCL+DLLGRA Sbjct: 400 IGILSACSHGGLVEEGRNFFNSMTTMYQIKPKLEHYGCLIDLLGRA 445 >ref|XP_004250591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Solanum lycopersicum] Length = 600 Score = 172 bits (436), Expect = 8e-41 Identities = 81/106 (76%), Positives = 91/106 (85%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKS E+F +EEKDTASWT+IIC LAM+G TR ALELFSEM+Q G PDDIT+ Sbjct: 386 YAKCGCIEKSKEIFDELEEKDTASWTSIICALAMSGNTRKALELFSEMEQAGFHPDDITY 445 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG YF M RI+ I+PK+EHYGCL+DLLGRA Sbjct: 446 IGVLSACSHGGLVEEGRKYFHAMSRIHAIQPKLEHYGCLIDLLGRA 491 >emb|CBI28142.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 171 bits (434), Expect = 1e-40 Identities = 80/106 (75%), Positives = 91/106 (85%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCG IEKS+E+F ++EKDTASWT+IICGLAMNG+T ALELF+EM Q G KPDDITF Sbjct: 319 YAKCGFIEKSLEIFNGLKEKDTASWTSIICGLAMNGKTSKALELFAEMVQTGVKPDDITF 378 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +F M +Y IEPK+EHYGCL+DLLGRA Sbjct: 379 IGVLSACSHGGLVEEGRKHFRSMTAVYQIEPKLEHYGCLIDLLGRA 424 >ref|XP_002281719.2| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Vitis vinifera] Length = 662 Score = 171 bits (434), Expect = 1e-40 Identities = 80/106 (75%), Positives = 91/106 (85%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCG IEKS+E+F ++EKDTASWT+IICGLAMNG+T ALELF+EM Q G KPDDITF Sbjct: 410 YAKCGFIEKSLEIFNGLKEKDTASWTSIICGLAMNGKTSKALELFAEMVQTGVKPDDITF 469 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +F M +Y IEPK+EHYGCL+DLLGRA Sbjct: 470 IGVLSACSHGGLVEEGRKHFRSMTAVYQIEPKLEHYGCLIDLLGRA 515 >ref|XP_009607091.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nicotiana tomentosiformis] Length = 625 Score = 170 bits (431), Expect = 3e-40 Identities = 80/106 (75%), Positives = 92/106 (86%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKS+E+F ++EKDTASWT+IIC LAM+G T+ ALELFS+M+Q G PDDITF Sbjct: 411 YAKCGCIEKSMEIFDGLKEKDTASWTSIICALAMSGNTKKALELFSQMEQGGFCPDDITF 470 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG YF M RIY I+PK+EHYGCL+DLLGRA Sbjct: 471 IGVLSACSHGGLVEEGRRYFHSMSRIYGIQPKLEHYGCLIDLLGRA 516 >ref|XP_010098972.1| hypothetical protein L484_025631 [Morus notabilis] gi|587887534|gb|EXB76274.1| hypothetical protein L484_025631 [Morus notabilis] Length = 564 Score = 170 bits (430), Expect = 4e-40 Identities = 78/106 (73%), Positives = 89/106 (83%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCI+KS+E+F+ V EKDTA+WT+IICGLAMNG++ ALELFSEM+Q G PDDITF Sbjct: 340 YAKCGCIDKSLEIFKEVREKDTAAWTSIICGLAMNGRSSKALELFSEMRQAGINPDDITF 399 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSH GLVEEG +F M IY IEPK EHYGCL+DL GRA Sbjct: 400 IGVLSACSHAGLVEEGRQFFHSMMEIYMIEPKYEHYGCLIDLFGRA 445 >ref|XP_002529360.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531180|gb|EEF33027.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 683 Score = 168 bits (425), Expect = 1e-39 Identities = 79/106 (74%), Positives = 91/106 (85%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCG IEK++E+F + KDTASWT+IICGLAMNG+T ALELFS+MKQ G +PDDITF Sbjct: 415 YAKCGFIEKALEIFYGLRVKDTASWTSIICGLAMNGKTSKALELFSKMKQAGVRPDDITF 474 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +F+ M+ Y I+PKVEHYGCLVDLLGRA Sbjct: 475 IGVLSACSHGGLVEEGRKFFNSMRMEYQIKPKVEHYGCLVDLLGRA 520 >ref|XP_007013319.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508783682|gb|EOY30938.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 626 Score = 167 bits (423), Expect = 2e-39 Identities = 73/106 (68%), Positives = 91/106 (85%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGC+E+++E+F + +KDTASWT++ICGLA+NG+ ALELFS+MKQ KPDDITF Sbjct: 414 YAKCGCVEEALEIFYGLSKKDTASWTSVICGLAVNGEASKALELFSQMKQTEEKPDDITF 473 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSAC+HGGLVEEG +FD M ++Y IEPK+EHY CL+DLLGRA Sbjct: 474 IGVLSACNHGGLVEEGRQFFDSMSKVYQIEPKLEHYACLIDLLGRA 519 >ref|XP_006385618.1| hypothetical protein POPTR_0003s08690g [Populus trichocarpa] gi|550342748|gb|ERP63415.1| hypothetical protein POPTR_0003s08690g [Populus trichocarpa] Length = 609 Score = 167 bits (422), Expect = 3e-39 Identities = 75/106 (70%), Positives = 92/106 (86%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 Y+KCGCIEK++ +F + EKDTA+WT+IICGLAMNG+T ALELFS+MKQ+ PD++TF Sbjct: 366 YSKCGCIEKALRIFCGLREKDTATWTSIICGLAMNGKTSKALELFSKMKQVEAIPDEVTF 425 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG +F+ M IY+IEPK+EHYGCL+DLLGRA Sbjct: 426 IGVLSACSHGGLVEEGREFFNSMTSIYNIEPKLEHYGCLIDLLGRA 471 >ref|XP_012574775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332538|ref|XP_012574776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332540|ref|XP_012574777.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332542|ref|XP_012574778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332544|ref|XP_012574779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332546|ref|XP_012574780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332548|ref|XP_012574781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] gi|828332550|ref|XP_012574782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] Length = 605 Score = 165 bits (418), Expect = 9e-39 Identities = 77/106 (72%), Positives = 87/106 (82%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIEKS+EVF ++EKDTASWT+IICGLAMNG+T+ ALELF EMK G KPDD+TF Sbjct: 376 YAKCGCIEKSLEVFNGLKEKDTASWTSIICGLAMNGKTKKALELFEEMKTFGAKPDDVTF 435 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 I +LSACSH GLVEEG F M IY IEP +EHYGC +DLLGRA Sbjct: 436 IVLLSACSHAGLVEEGRRLFHSMSCIYDIEPNLEHYGCFIDLLGRA 481 >ref|XP_012447935.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Gossypium raimondii] gi|763787122|gb|KJB54118.1| hypothetical protein B456_009G021500 [Gossypium raimondii] Length = 621 Score = 165 bits (417), Expect = 1e-38 Identities = 73/106 (68%), Positives = 91/106 (85%) Frame = -3 Query: 320 YAKCGCIEKSIEVFRSVEEKDTASWTAIICGLAMNGQTRTALELFSEMKQIGTKPDDITF 141 YAKCGCIE+++E+F + ++DTASWT+IICG+A+NG+T ALELFSEM+Q KPDDITF Sbjct: 411 YAKCGCIEEALEIFYGLRKRDTASWTSIICGMAVNGETSKALELFSEMEQTNEKPDDITF 470 Query: 140 IGVLSACSHGGLVEEGCSYFDLMKRIYHIEPKVEHYGCLVDLLGRA 3 IGVLSACSHGGLVEEG FD + ++YH+EPK+EHY CL+DLL RA Sbjct: 471 IGVLSACSHGGLVEEGRKVFDSISKVYHMEPKLEHYACLIDLLCRA 516