BLASTX nr result
ID: Cinnamomum25_contig00015310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00015310 (460 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB23945.1| hypothetical protein B456_004G122600 [Gossypium r... 76 1e-11 ref|XP_012474637.1| PREDICTED: general transcription factor 3C p... 76 1e-11 gb|KHG20860.1| General transcription factor 3C polypeptide 5 [Go... 75 1e-11 ref|XP_011011391.1| PREDICTED: general transcription factor 3C p... 73 9e-11 ref|XP_007039140.1| Transcription factor IIIC, subunit 5, putati... 73 9e-11 ref|XP_007039139.1| Transcription factor IIIC, subunit 5, putati... 73 9e-11 ref|XP_007039138.1| General transcription factor 3C polypeptide ... 73 9e-11 ref|XP_011011386.1| PREDICTED: general transcription factor 3C p... 72 1e-10 ref|XP_011011385.1| PREDICTED: general transcription factor 3C p... 72 1e-10 ref|XP_011001845.1| PREDICTED: LOW QUALITY PROTEIN: general tran... 72 1e-10 ref|XP_002323927.1| transcription factor-related family protein ... 72 1e-10 ref|XP_002309715.1| transcription factor-related family protein ... 72 1e-10 ref|XP_010650749.1| PREDICTED: uncharacterized protein LOC100247... 72 2e-10 emb|CBI24753.3| unnamed protein product [Vitis vinifera] 72 2e-10 emb|CAN77265.1| hypothetical protein VITISV_041157 [Vitis vinifera] 72 2e-10 ref|XP_002529107.1| conserved hypothetical protein [Ricinus comm... 70 6e-10 ref|XP_012575688.1| PREDICTED: general transcription factor 3C p... 70 7e-10 ref|XP_012081924.1| PREDICTED: general transcription factor 3C p... 70 7e-10 ref|XP_011465770.1| PREDICTED: general transcription factor 3C p... 70 7e-10 ref|XP_004287180.2| PREDICTED: general transcription factor 3C p... 70 7e-10 >gb|KJB23945.1| hypothetical protein B456_004G122600 [Gossypium raimondii] gi|763756615|gb|KJB23946.1| hypothetical protein B456_004G122600 [Gossypium raimondii] gi|763756616|gb|KJB23947.1| hypothetical protein B456_004G122600 [Gossypium raimondii] Length = 586 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EGR+SG LP EAF+VHYPGYP +TSRAI+TLGGTEGILK Sbjct: 1 MGVIKEGRVSGTLPKDEAFAVHYPGYPKTTSRAIQTLGGTEGILK 45 >ref|XP_012474637.1| PREDICTED: general transcription factor 3C polypeptide 5-like [Gossypium raimondii] gi|763756613|gb|KJB23944.1| hypothetical protein B456_004G122600 [Gossypium raimondii] gi|763756617|gb|KJB23948.1| hypothetical protein B456_004G122600 [Gossypium raimondii] gi|763756618|gb|KJB23949.1| hypothetical protein B456_004G122600 [Gossypium raimondii] gi|763756619|gb|KJB23950.1| hypothetical protein B456_004G122600 [Gossypium raimondii] gi|763756621|gb|KJB23952.1| hypothetical protein B456_004G122600 [Gossypium raimondii] Length = 591 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EGR+SG LP EAF+VHYPGYP +TSRAI+TLGGTEGILK Sbjct: 1 MGVIKEGRVSGTLPKDEAFAVHYPGYPKTTSRAIQTLGGTEGILK 45 >gb|KHG20860.1| General transcription factor 3C polypeptide 5 [Gossypium arboreum] Length = 608 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EGR+SG LP EAF++HYPGYP +TSRAI+TLGGTEGILK Sbjct: 1 MGVIKEGRVSGTLPKDEAFAIHYPGYPKTTSRAIQTLGGTEGILK 45 >ref|XP_011011391.1| PREDICTED: general transcription factor 3C polypeptide 5-like [Populus euphratica] Length = 554 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG++SG +P E F+VHYPGYPSS SRAI+TLGGTE ILK Sbjct: 1 MGVIEEGKVSGLIPSKEGFAVHYPGYPSSVSRAIQTLGGTESILK 45 >ref|XP_007039140.1| Transcription factor IIIC, subunit 5, putative isoform 3 [Theobroma cacao] gi|508776385|gb|EOY23641.1| Transcription factor IIIC, subunit 5, putative isoform 3 [Theobroma cacao] Length = 579 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EGR+SG LP+ E+F+VH+PGYP +T+RAIETLGGTEGIL+ Sbjct: 1 MGVIKEGRVSGTLPNDESFAVHFPGYPKTTARAIETLGGTEGILR 45 >ref|XP_007039139.1| Transcription factor IIIC, subunit 5, putative isoform 2 [Theobroma cacao] gi|508776384|gb|EOY23640.1| Transcription factor IIIC, subunit 5, putative isoform 2 [Theobroma cacao] Length = 582 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EGR+SG LP+ E+F+VH+PGYP +T+RAIETLGGTEGIL+ Sbjct: 1 MGVIKEGRVSGTLPNDESFAVHFPGYPKTTARAIETLGGTEGILR 45 >ref|XP_007039138.1| General transcription factor 3C polypeptide 5, putative isoform 1 [Theobroma cacao] gi|508776383|gb|EOY23639.1| General transcription factor 3C polypeptide 5, putative isoform 1 [Theobroma cacao] Length = 630 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EGR+SG LP+ E+F+VH+PGYP +T+RAIETLGGTEGIL+ Sbjct: 1 MGVIKEGRVSGTLPNDESFAVHFPGYPKTTARAIETLGGTEGILR 45 >ref|XP_011011386.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Populus euphratica] Length = 549 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG++SG +P E F+VHYPGYPSS SRAI+TLGGTE ILK Sbjct: 1 MGVIKEGKVSGLIPSKEGFAVHYPGYPSSISRAIQTLGGTESILK 45 >ref|XP_011011385.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Populus euphratica] Length = 558 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG++SG +P E F+VHYPGYPSS SRAI+TLGGTE ILK Sbjct: 1 MGVIKEGKVSGLIPSKEGFAVHYPGYPSSISRAIQTLGGTESILK 45 >ref|XP_011001845.1| PREDICTED: LOW QUALITY PROTEIN: general transcription factor 3C polypeptide 5-like [Populus euphratica] Length = 558 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG++SG +P E F+VHYPGYPSS SRAI+TLGGTE ILK Sbjct: 1 MGVIKEGKVSGLIPSKEGFAVHYPGYPSSISRAIQTLGGTESILK 45 >ref|XP_002323927.1| transcription factor-related family protein [Populus trichocarpa] gi|222866929|gb|EEF04060.1| transcription factor-related family protein [Populus trichocarpa] Length = 527 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG++SG +P E F+VHYPGYPSS SRAI+TLGGTE ILK Sbjct: 1 MGVIKEGKVSGLIPSKEGFAVHYPGYPSSISRAIQTLGGTESILK 45 >ref|XP_002309715.1| transcription factor-related family protein [Populus trichocarpa] gi|222852618|gb|EEE90165.1| transcription factor-related family protein [Populus trichocarpa] Length = 515 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG I EG++SG +P E F+VHYPGYPSSTSRAI+TLGGTE ILK Sbjct: 1 MGEIKEGKVSGLIPRNEGFAVHYPGYPSSTSRAIQTLGGTESILK 45 >ref|XP_010650749.1| PREDICTED: uncharacterized protein LOC100247425 [Vitis vinifera] Length = 599 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG ISG++P EAFSVHYP YPSST+RAIETLGGT+ I K Sbjct: 1 MGVIEEGSISGYIPSNEAFSVHYPAYPSSTARAIETLGGTQAIRK 45 >emb|CBI24753.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG ISG++P EAFSVHYP YPSST+RAIETLGGT+ I K Sbjct: 1 MGVIEEGSISGYIPSNEAFSVHYPAYPSSTARAIETLGGTQAIRK 45 >emb|CAN77265.1| hypothetical protein VITISV_041157 [Vitis vinifera] Length = 242 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG ISG++P EAFSVHYP YPSST+RAIETLGGT+ I K Sbjct: 1 MGVIEEGSISGYIPSNEAFSVHYPAYPSSTARAIETLGGTQAIRK 45 >ref|XP_002529107.1| conserved hypothetical protein [Ricinus communis] gi|223531458|gb|EEF33291.1| conserved hypothetical protein [Ricinus communis] Length = 540 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I EG SG +P EAF+VHYPGYPSS SRAI+TLGGT+ ILK Sbjct: 1 MGVIKEGEASGIIPSNEAFAVHYPGYPSSISRAIQTLGGTDAILK 45 >ref|XP_012575688.1| PREDICTED: general transcription factor 3C polypeptide 5-like [Cicer arietinum] Length = 562 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I +G ISG LP+ + F VHYPGYPSSTSRA++TLGG +GILK Sbjct: 1 MGVIKDGTISGVLPEPQGFLVHYPGYPSSTSRAVDTLGGIQGILK 45 >ref|XP_012081924.1| PREDICTED: general transcription factor 3C polypeptide 5-like [Jatropha curcas] Length = 553 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG+I +G++SG +P+ EAF+VHYPGYPSS SRAI+TLGG E ILK Sbjct: 1 MGVIKDGKVSGTIPNNEAFAVHYPGYPSSMSRAIQTLGGQESILK 45 >ref|XP_011465770.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Fragaria vesca subsp. vesca] Length = 547 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG++ +G ISGFLP +AF VHYPGYPSS SRAI+TLGGT+ I K Sbjct: 11 MGVVKDGTISGFLPSTQAFGVHYPGYPSSMSRAIDTLGGTQAIHK 55 >ref|XP_004287180.2| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Fragaria vesca subsp. vesca] gi|764506490|ref|XP_011465739.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Fragaria vesca subsp. vesca] Length = 550 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -2 Query: 135 MGLITEGRISGFLPDLEAFSVHYPGYPSSTSRAIETLGGTEGILK 1 MG++ +G ISGFLP +AF VHYPGYPSS SRAI+TLGGT+ I K Sbjct: 11 MGVVKDGTISGFLPSTQAFGVHYPGYPSSMSRAIDTLGGTQAIHK 55