BLASTX nr result
ID: Cinnamomum25_contig00015084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00015084 (289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46517.1| unknown [Medicago truncatula] 82 1e-13 ref|XP_003602742.1| Sec14 cytosolic factor [Medicago truncatula]... 82 1e-13 gb|KHN09704.1| Random slug protein 5 [Glycine soja] 81 2e-13 ref|XP_003523178.1| PREDICTED: random slug protein 5-like [Glyci... 81 2e-13 ref|NP_001241473.1| uncharacterized protein LOC100797666 [Glycin... 81 2e-13 ref|XP_008366414.1| PREDICTED: sec14 cytosolic factor-like isofo... 80 4e-13 ref|XP_008366412.1| PREDICTED: sec14 cytosolic factor-like isofo... 80 4e-13 gb|ACJ85443.1| unknown [Medicago truncatula] 80 4e-13 ref|XP_011082916.1| PREDICTED: random slug protein 5-like [Sesam... 80 5e-13 ref|XP_002511081.1| aspartate semialdehyde dehydrogenase, putati... 80 5e-13 ref|XP_006373203.1| hypothetical protein POPTR_0017s09620g [Popu... 80 5e-13 ref|XP_008369620.1| PREDICTED: sec14 cytosolic factor-like [Malu... 80 7e-13 ref|XP_012856601.1| PREDICTED: random slug protein 5-like [Eryth... 80 7e-13 gb|AFK49285.1| unknown [Lotus japonicus] 80 7e-13 ref|XP_007137847.1| hypothetical protein PHAVU_009G160800g [Phas... 79 9e-13 ref|XP_007038166.1| Sec14p-like phosphatidylinositol transfer fa... 79 9e-13 ref|XP_007038164.1| Sec14p-like phosphatidylinositol transfer fa... 79 9e-13 ref|XP_006844455.2| PREDICTED: random slug protein 5 [Amborella ... 79 1e-12 gb|KJB12436.1| hypothetical protein B456_002G021200 [Gossypium r... 79 1e-12 gb|KJB12434.1| hypothetical protein B456_002G021200 [Gossypium r... 79 1e-12 >gb|AFK46517.1| unknown [Medicago truncatula] Length = 272 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFVENK LK TLLEEIDES+LPE YGGK+PLVPI++ Sbjct: 224 YPFIDDNTKKKIVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQD 271 >ref|XP_003602742.1| Sec14 cytosolic factor [Medicago truncatula] gi|355491790|gb|AES72993.1| polyphosphoinositide-binding protein [Medicago truncatula] gi|388521721|gb|AFK48922.1| unknown [Medicago truncatula] Length = 272 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFVENK LK TLLEEIDES+LPE YGGK+PLVPI++ Sbjct: 224 YPFIDDNTKKKIVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQD 271 >gb|KHN09704.1| Random slug protein 5 [Glycine soja] Length = 265 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFVENK LK TLLEEI+ES+LP+ YGG+MPLVPI+N Sbjct: 217 YPFIDDNTKKKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQN 264 >ref|XP_003523178.1| PREDICTED: random slug protein 5-like [Glycine max] gi|734400161|gb|KHN31247.1| Random slug protein 5 [Glycine soja] Length = 264 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID+NT+ KIVFVENK LK TLLEEI+ES++P+ YGG+MPLVPI+N Sbjct: 216 YPFIDENTKKKIVFVENKKLKSTLLEEIEESQIPDIYGGQMPLVPIQN 263 >ref|NP_001241473.1| uncharacterized protein LOC100797666 [Glycine max] gi|255644714|gb|ACU22859.1| unknown [Glycine max] gi|255645031|gb|ACU23015.1| unknown [Glycine max] Length = 265 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFVENK LK TLLEEI+ES+LP+ YGG+MPLVPI+N Sbjct: 217 YPFIDDNTKKKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQN 264 >ref|XP_008366414.1| PREDICTED: sec14 cytosolic factor-like isoform X2 [Malus domestica] Length = 228 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPI 150 YPFID T+ KIVFVENK+LK TLLEEIDES+LPE YGGK+PLVPI Sbjct: 183 YPFIDNKTKKKIVFVENKMLKSTLLEEIDESQLPEIYGGKLPLVPI 228 >ref|XP_008366412.1| PREDICTED: sec14 cytosolic factor-like isoform X1 [Malus domestica] Length = 238 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPI 150 YPFID T+ KIVFVENK+LK TLLEEIDES+LPE YGGK+PLVPI Sbjct: 193 YPFIDNKTKKKIVFVENKMLKSTLLEEIDESQLPEIYGGKLPLVPI 238 >gb|ACJ85443.1| unknown [Medicago truncatula] Length = 272 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFVENK L+ TLLEEIDES+LPE YGGK+PLVPI++ Sbjct: 224 YPFIDDNTKKKIVFVENKKLEATLLEEIDESQLPEIYGGKLPLVPIQD 271 >ref|XP_011082916.1| PREDICTED: random slug protein 5-like [Sesamum indicum] Length = 274 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID+NTR KI+FVENK L+ TLLEEIDES+LPE YGGKM LVPI++ Sbjct: 226 YPFIDENTRKKIIFVENKKLQATLLEEIDESQLPEIYGGKMQLVPIQD 273 >ref|XP_002511081.1| aspartate semialdehyde dehydrogenase, putative [Ricinus communis] gi|223550196|gb|EEF51683.1| aspartate semialdehyde dehydrogenase, putative [Ricinus communis] Length = 209 Score = 80.1 bits (196), Expect = 5e-13 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPI 150 YPFID+NTR KI+FVENK LK TLLE+IDES++PE YGGK+PLVPI Sbjct: 163 YPFIDQNTREKILFVENKKLKSTLLEDIDESQIPEIYGGKLPLVPI 208 >ref|XP_006373203.1| hypothetical protein POPTR_0017s09620g [Populus trichocarpa] gi|550319909|gb|ERP51000.1| hypothetical protein POPTR_0017s09620g [Populus trichocarpa] Length = 278 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPI 150 YPFIDKNTR KIVFV+N+ LK TLLEEIDES++P+ YGGK+PL+PI Sbjct: 229 YPFIDKNTRKKIVFVDNRKLKSTLLEEIDESQIPDIYGGKLPLIPI 274 >ref|XP_008369620.1| PREDICTED: sec14 cytosolic factor-like [Malus domestica] Length = 258 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFIDK T+ KI+FVENK L TLL++IDES+LPE YGGK+PLVPI+N Sbjct: 210 YPFIDKKTKKKIIFVENKKLNSTLLKDIDESQLPEAYGGKLPLVPIQN 257 >ref|XP_012856601.1| PREDICTED: random slug protein 5-like [Erythranthe guttatus] gi|604302174|gb|EYU21760.1| hypothetical protein MIMGU_mgv1a011582mg [Erythranthe guttata] Length = 277 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 284 PFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 PFIDKNTR KIVFVENK L+ETLLE+IDES+LP+ YGGK+ LVP++N Sbjct: 230 PFIDKNTRKKIVFVENKRLRETLLEDIDESQLPDIYGGKLQLVPVQN 276 >gb|AFK49285.1| unknown [Lotus japonicus] Length = 110 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFV+NK LK TLLEEIDES+LPE YGG++PLVPI++ Sbjct: 62 YPFIDDNTKKKIVFVDNKKLKSTLLEEIDESQLPEIYGGQLPLVPIQD 109 >ref|XP_007137847.1| hypothetical protein PHAVU_009G160800g [Phaseolus vulgaris] gi|561010934|gb|ESW09841.1| hypothetical protein PHAVU_009G160800g [Phaseolus vulgaris] Length = 264 Score = 79.3 bits (194), Expect = 9e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID NT+ KIVFVENK LK TLLEEI+ES+LP+ YGG+MPLVPI++ Sbjct: 216 YPFIDDNTKKKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQD 263 >ref|XP_007038166.1| Sec14p-like phosphatidylinositol transfer family protein, putative isoform 3 [Theobroma cacao] gi|508775411|gb|EOY22667.1| Sec14p-like phosphatidylinositol transfer family protein, putative isoform 3 [Theobroma cacao] Length = 239 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID TR KIVFV +K LK TLLEEIDES+LPETYGGK+PLVPI + Sbjct: 191 YPFIDNKTRKKIVFVGSKTLKSTLLEEIDESQLPETYGGKLPLVPIHD 238 >ref|XP_007038164.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gi|508775409|gb|EOY22665.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] Length = 255 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID TR KIVFV +K LK TLLEEIDES+LPETYGGK+PLVPI + Sbjct: 207 YPFIDNKTRKKIVFVGSKTLKSTLLEEIDESQLPETYGGKLPLVPIHD 254 >ref|XP_006844455.2| PREDICTED: random slug protein 5 [Amborella trichopoda] Length = 247 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIE 147 YPFIDKNTR KIVFVENK L+ LL+EIDE++LPE YGGK+PL+PI+ Sbjct: 197 YPFIDKNTREKIVFVENKSLQSVLLKEIDENQLPEIYGGKLPLIPIQ 243 >gb|KJB12436.1| hypothetical protein B456_002G021200 [Gossypium raimondii] Length = 249 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID T+ KI+FVENK LK TLL +IDES+LP+ YGGK+PLVPIEN Sbjct: 201 YPFIDSRTKKKIIFVENKKLKSTLLNDIDESQLPDIYGGKLPLVPIEN 248 >gb|KJB12434.1| hypothetical protein B456_002G021200 [Gossypium raimondii] Length = 301 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 287 YPFIDKNTRNKIVFVENKVLKETLLEEIDESELPETYGGKMPLVPIEN 144 YPFID T+ KI+FVENK LK TLL +IDES+LP+ YGGK+PLVPIEN Sbjct: 253 YPFIDSRTKKKIIFVENKKLKSTLLNDIDESQLPDIYGGKLPLVPIEN 300