BLASTX nr result
ID: Cinnamomum25_contig00014445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00014445 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010049750.1| PREDICTED: WD-40 repeat-containing protein M... 61 3e-07 gb|KCW82508.1| hypothetical protein EUGRSUZ_C039012, partial [Eu... 61 3e-07 ref|XP_008795452.1| PREDICTED: WD-40 repeat-containing protein M... 60 4e-07 ref|XP_004969719.1| PREDICTED: WD-40 repeat-containing protein M... 60 4e-07 ref|XP_010447816.1| PREDICTED: WD-40 repeat-containing protein M... 60 6e-07 ref|XP_010438274.1| PREDICTED: LOW QUALITY PROTEIN: WD-40 repeat... 60 6e-07 ref|XP_010433073.1| PREDICTED: WD-40 repeat-containing protein M... 60 6e-07 ref|XP_010090046.1| WD-40 repeat-containing protein MSI4 [Morus ... 60 7e-07 ref|XP_012450880.1| PREDICTED: WD-40 repeat-containing protein M... 60 7e-07 gb|KJB54376.1| hypothetical protein B456_009G031600 [Gossypium r... 60 7e-07 gb|KJB54375.1| hypothetical protein B456_009G031600 [Gossypium r... 60 7e-07 gb|KJB54374.1| hypothetical protein B456_009G031600 [Gossypium r... 60 7e-07 ref|XP_012444369.1| PREDICTED: WD-40 repeat-containing protein M... 60 7e-07 ref|XP_010924995.1| PREDICTED: WD-40 repeat-containing protein M... 60 7e-07 ref|XP_010667163.1| PREDICTED: WD-40 repeat-containing protein M... 60 7e-07 gb|KHG09090.1| WD-40 repeat-containing MSI4 -like protein [Gossy... 60 7e-07 gb|KHG05443.1| WD-40 repeat-containing protein MSI4 [Gossypium a... 60 7e-07 gb|KHG05442.1| WD-40 repeat-containing protein MSI4 [Gossypium a... 60 7e-07 ref|XP_010242216.1| PREDICTED: WD-40 repeat-containing protein M... 60 7e-07 ref|XP_010262125.1| PREDICTED: WD-40 repeat-containing protein M... 60 7e-07 >ref|XP_010049750.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Eucalyptus grandis] Length = 518 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELENFK+H Sbjct: 480 GGGGTLQIWRMSDLIYRPEEEVLAELENFKAH 511 >gb|KCW82508.1| hypothetical protein EUGRSUZ_C039012, partial [Eucalyptus grandis] Length = 347 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELENFK+H Sbjct: 309 GGGGTLQIWRMSDLIYRPEEEVLAELENFKAH 340 >ref|XP_008795452.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Phoenix dactylifera] Length = 467 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDL+YR EEVLAE+ENFKSH Sbjct: 428 GGGGTLQIWRMSDLLYRPEEEVLAEMENFKSH 459 >ref|XP_004969719.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Setaria italica] Length = 453 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVL ELENFKSH Sbjct: 414 GGGGTLQIWRMSDLIYRPEEEVLTELENFKSH 445 >ref|XP_010447816.1| PREDICTED: WD-40 repeat-containing protein MSI5-like [Camelina sativa] Length = 490 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSHAF 200 GGGGTLQ WR+SDLIYR EEVL ELE FKSH F Sbjct: 451 GGGGTLQIWRLSDLIYRAEEEVLTELEKFKSHVF 484 >ref|XP_010438274.1| PREDICTED: LOW QUALITY PROTEIN: WD-40 repeat-containing protein MSI5-like [Camelina sativa] Length = 490 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSHAF 200 GGGGTLQ WR+SDLIYR EEVL ELE FKSH F Sbjct: 451 GGGGTLQIWRLSDLIYRAEEEVLTELEKFKSHVF 484 >ref|XP_010433073.1| PREDICTED: WD-40 repeat-containing protein MSI5-like [Camelina sativa] Length = 488 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSHAF 200 GGGGTLQ WR+SDLIYR EEVL ELE FKSH F Sbjct: 449 GGGGTLQIWRLSDLIYRAEEEVLTELEKFKSHVF 482 >ref|XP_010090046.1| WD-40 repeat-containing protein MSI4 [Morus notabilis] gi|587848584|gb|EXB38843.1| WD-40 repeat-containing protein MSI4 [Morus notabilis] Length = 527 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 488 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 519 >ref|XP_012450880.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Gossypium raimondii] gi|763798220|gb|KJB65175.1| hypothetical protein B456_010G083100 [Gossypium raimondii] Length = 489 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 450 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 481 >gb|KJB54376.1| hypothetical protein B456_009G031600 [Gossypium raimondii] Length = 503 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 464 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 495 >gb|KJB54375.1| hypothetical protein B456_009G031600 [Gossypium raimondii] Length = 454 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 415 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 446 >gb|KJB54374.1| hypothetical protein B456_009G031600 [Gossypium raimondii] Length = 497 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 458 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 489 >ref|XP_012444369.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Gossypium raimondii] gi|763787377|gb|KJB54373.1| hypothetical protein B456_009G031600 [Gossypium raimondii] Length = 502 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 463 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 494 >ref|XP_010924995.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Elaeis guineensis] Length = 467 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 428 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 459 >ref|XP_010667163.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Beta vulgaris subsp. vulgaris] gi|870842054|gb|KMS95564.1| hypothetical protein BVRB_007100 [Beta vulgaris subsp. vulgaris] Length = 510 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 471 GGGGTLQIWRMSDLIYRPEEEVLAELEEFKSH 502 >gb|KHG09090.1| WD-40 repeat-containing MSI4 -like protein [Gossypium arboreum] Length = 509 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 470 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 501 >gb|KHG05443.1| WD-40 repeat-containing protein MSI4 [Gossypium arboreum] Length = 486 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 447 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 478 >gb|KHG05442.1| WD-40 repeat-containing protein MSI4 [Gossypium arboreum] Length = 510 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 471 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 502 >ref|XP_010242216.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Nelumbo nucifera] Length = 465 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 426 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 457 >ref|XP_010262125.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Nelumbo nucifera] Length = 465 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 301 GGGGTLQTWRMSDLIYRLAEEVLAELENFKSH 206 GGGGTLQ WRMSDLIYR EEVLAELE FKSH Sbjct: 426 GGGGTLQIWRMSDLIYRPEEEVLAELEKFKSH 457