BLASTX nr result
ID: Cinnamomum25_contig00014407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00014407 (408 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934792.1| PREDICTED: uncharacterized protein LOC105054... 58 2e-06 ref|XP_002531705.1| conserved hypothetical protein [Ricinus comm... 57 6e-06 >ref|XP_010934792.1| PREDICTED: uncharacterized protein LOC105054863 [Elaeis guineensis] Length = 413 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 104 GGIPISQQRLEVRNHLKRLNKPAVKSIKSPDGDI 3 G + +++QRLEVR HLKR NKPAVKSIKSPDGDI Sbjct: 26 GAVRVARQRLEVRRHLKRFNKPAVKSIKSPDGDI 59 >ref|XP_002531705.1| conserved hypothetical protein [Ricinus communis] gi|223528648|gb|EEF30664.1| conserved hypothetical protein [Ricinus communis] Length = 401 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 101 GIPISQQRLEVRNHLKRLNKPAVKSIKSPDGDI 3 G +SQQ+L+VRNHL RLNKP VKSIKSPDGDI Sbjct: 9 GSSLSQQKLDVRNHLNRLNKPPVKSIKSPDGDI 41