BLASTX nr result
ID: Cinnamomum25_contig00014235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00014235 (389 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009420096.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 114 3e-23 ref|XP_010931260.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 111 2e-22 ref|XP_008802745.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 110 5e-22 ref|XP_008802744.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 110 5e-22 ref|XP_008776809.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 110 5e-22 ref|XP_008776804.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 110 5e-22 ref|XP_006846167.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 110 5e-22 ref|XP_004981245.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 107 2e-21 ref|NP_001140935.1| uncharacterized protein LOC100273013 [Zea ma... 105 9e-21 tpg|DAA52219.1| TPA: hypothetical protein ZEAMMB73_791742 [Zea m... 105 9e-21 ref|XP_006651480.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 103 3e-20 emb|CDM81783.1| unnamed protein product [Triticum aestivum] 102 1e-19 gb|EMT32215.1| hypothetical protein F775_11466 [Aegilops tauschii] 102 1e-19 dbj|BAK06079.1| predicted protein [Hordeum vulgare subsp. vulgare] 102 1e-19 gb|EEC76428.1| hypothetical protein OsI_14108 [Oryza sativa Indi... 101 2e-19 gb|AAO18453.1| putative dolichyl-phosphate beta-glucosyltransfer... 101 2e-19 ref|NP_001051729.1| Os03g0821800 [Oryza sativa Japonica Group] g... 101 2e-19 ref|XP_003563584.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 101 2e-19 ref|XP_002961154.1| hypothetical protein SELMODRAFT_73379 [Selag... 100 6e-19 ref|XP_002966855.1| hypothetical protein SELMODRAFT_168631 [Sela... 100 6e-19 >ref|XP_009420096.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Musa acuminata subsp. malaccensis] Length = 338 Score = 114 bits (285), Expect = 3e-23 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L+IPMIEVSVNWSEI GSKVRLTSI+HMLFEL+LIRLGYGLG+WKIH Sbjct: 278 WCFDVELVYLCKHLSIPMIEVSVNWSEIPGSKVRLTSIIHMLFELILIRLGYGLGIWKIH 337 >ref|XP_010931260.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Elaeis guineensis] Length = 347 Score = 111 bits (277), Expect = 2e-22 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM+EVSV WSEI GSKVRLTSI+HMLFEL+LIRLGYGLG+WKIH Sbjct: 287 WCFDVELVYLCKHLGIPMVEVSVTWSEIPGSKVRLTSIIHMLFELILIRLGYGLGIWKIH 346 >ref|XP_008802745.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Phoenix dactylifera] Length = 301 Score = 110 bits (274), Expect = 5e-22 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPMIEVSV WSEI GSKVR+TSIMHMLFEL+LIRLGYGLG+WKI+ Sbjct: 241 WCFDVELVYLCKHLGIPMIEVSVTWSEIPGSKVRMTSIMHMLFELILIRLGYGLGIWKIY 300 >ref|XP_008802744.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Phoenix dactylifera] Length = 346 Score = 110 bits (274), Expect = 5e-22 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPMIEVSV WSEI GSKVR+TSIMHMLFEL+LIRLGYGLG+WKI+ Sbjct: 286 WCFDVELVYLCKHLGIPMIEVSVTWSEIPGSKVRMTSIMHMLFELILIRLGYGLGIWKIY 345 >ref|XP_008776809.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Phoenix dactylifera] Length = 353 Score = 110 bits (274), Expect = 5e-22 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM+EVSV WSEI GSKVRLTSI+HMLFEL+LIR+GYGLG+WKIH Sbjct: 293 WCFDVELVYLCKHLGIPMVEVSVTWSEIPGSKVRLTSIIHMLFELILIRVGYGLGIWKIH 352 >ref|XP_008776804.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Phoenix dactylifera] Length = 363 Score = 110 bits (274), Expect = 5e-22 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM+EVSV WSEI GSKVRLTSI+HMLFEL+LIR+GYGLG+WKIH Sbjct: 303 WCFDVELVYLCKHLGIPMVEVSVTWSEIPGSKVRLTSIIHMLFELILIRVGYGLGIWKIH 362 >ref|XP_006846167.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Amborella trichopoda] gi|548848937|gb|ERN07842.1| hypothetical protein AMTR_s00012p00197190 [Amborella trichopoda] Length = 339 Score = 110 bits (274), Expect = 5e-22 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKI 211 WCFDVELVYL K LNIPMIE+SVNWSEI GSKVR+TSI+HMLFEL+LIR GYGLG+WKI Sbjct: 279 WCFDVELVYLCKYLNIPMIEISVNWSEIPGSKVRMTSILHMLFELLLIRTGYGLGIWKI 337 >ref|XP_004981245.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase isoform X1 [Setaria italica] Length = 351 Score = 107 bits (268), Expect = 2e-21 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM+EVSVNW+EI GSKVR+TSIMHM+FEL+LIR+GYGLG+WKI+ Sbjct: 291 WCFDVELVYLCKHLRIPMVEVSVNWTEIPGSKVRMTSIMHMVFELLLIRVGYGLGIWKIY 350 >ref|NP_001140935.1| uncharacterized protein LOC100273013 [Zea mays] gi|194701826|gb|ACF84997.1| unknown [Zea mays] gi|194703532|gb|ACF85850.1| unknown [Zea mays] Length = 350 Score = 105 bits (263), Expect = 9e-21 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKI 211 WCFDVELVYL K L IPM+EVSVNW+EI GSKVR+TSIMHM+FEL+LI++GYGLG+WKI Sbjct: 290 WCFDVELVYLCKRLRIPMVEVSVNWTEIPGSKVRMTSIMHMVFELLLIKVGYGLGIWKI 348 >tpg|DAA52219.1| TPA: hypothetical protein ZEAMMB73_791742 [Zea mays] Length = 397 Score = 105 bits (263), Expect = 9e-21 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKI 211 WCFDVELVYL K L IPM+EVSVNW+EI GSKVR+TSIMHM+FEL+LI++GYGLG+WKI Sbjct: 337 WCFDVELVYLCKRLRIPMVEVSVNWTEIPGSKVRMTSIMHMVFELLLIKVGYGLGIWKI 395 >ref|XP_006651480.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Oryza brachyantha] Length = 374 Score = 103 bits (258), Expect = 3e-20 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM EVSVNW+EI GSKVR+TSI+HM+FEL+LI++GYGLG+WKI+ Sbjct: 314 WCFDVELVYLCKHLRIPMAEVSVNWTEIPGSKVRMTSILHMVFELLLIKVGYGLGIWKIY 373 >emb|CDM81783.1| unnamed protein product [Triticum aestivum] Length = 346 Score = 102 bits (254), Expect = 1e-19 Identities = 45/60 (75%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVE+VYL K L IPM EVSV+W+EI GSKVR+TSI+HM+FEL+LIR+GYGLG+WKI+ Sbjct: 286 WCFDVEIVYLCKHLRIPMAEVSVSWTEIPGSKVRMTSILHMVFELLLIRVGYGLGIWKIY 345 >gb|EMT32215.1| hypothetical protein F775_11466 [Aegilops tauschii] Length = 354 Score = 102 bits (254), Expect = 1e-19 Identities = 45/60 (75%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVE+VYL K L IPM EVSV+W+EI GSKVR+TSI+HM+FEL+LIR+GYGLG+WKI+ Sbjct: 294 WCFDVEIVYLCKHLRIPMAEVSVSWTEIPGSKVRMTSILHMVFELLLIRVGYGLGIWKIY 353 >dbj|BAK06079.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 351 Score = 102 bits (254), Expect = 1e-19 Identities = 45/60 (75%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVE+VYL K L IPM EVSV+W+EI GSKVR+TSI+HM+FEL+LIR+GYGLG+WKI+ Sbjct: 291 WCFDVEIVYLCKHLRIPMAEVSVSWTEIPGSKVRMTSILHMVFELLLIRVGYGLGIWKIY 350 >gb|EEC76428.1| hypothetical protein OsI_14108 [Oryza sativa Indica Group] Length = 352 Score = 101 bits (252), Expect = 2e-19 Identities = 45/60 (75%), Positives = 54/60 (90%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM EVSVNW+EI GSKVR+TSI+HM+FEL+LI++GYGL +WKI+ Sbjct: 292 WCFDVELVYLCKHLRIPMAEVSVNWTEIPGSKVRMTSILHMVFELLLIKVGYGLSIWKIY 351 >gb|AAO18453.1| putative dolichyl-phosphate beta-glucosyltransferase [Oryza sativa Japonica Group] Length = 380 Score = 101 bits (252), Expect = 2e-19 Identities = 45/60 (75%), Positives = 54/60 (90%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM EVSVNW+EI GSKVR+TSI+HM+FEL+LI++GYGL +WKI+ Sbjct: 320 WCFDVELVYLCKHLRIPMAEVSVNWTEIPGSKVRMTSILHMVFELLLIKVGYGLSIWKIY 379 >ref|NP_001051729.1| Os03g0821800 [Oryza sativa Japonica Group] gi|108711803|gb|ABF99598.1| glycosyl transferase, group 2 family protein, expressed [Oryza sativa Japonica Group] gi|113550200|dbj|BAF13643.1| Os03g0821800 [Oryza sativa Japonica Group] gi|215717119|dbj|BAG95482.1| unnamed protein product [Oryza sativa Japonica Group] gi|222626064|gb|EEE60196.1| hypothetical protein OsJ_13154 [Oryza sativa Japonica Group] Length = 352 Score = 101 bits (252), Expect = 2e-19 Identities = 45/60 (75%), Positives = 54/60 (90%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVELVYL K L IPM EVSVNW+EI GSKVR+TSI+HM+FEL+LI++GYGL +WKI+ Sbjct: 292 WCFDVELVYLCKHLRIPMAEVSVNWTEIPGSKVRMTSILHMVFELLLIKVGYGLSIWKIY 351 >ref|XP_003563584.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Brachypodium distachyon] Length = 351 Score = 101 bits (251), Expect = 2e-19 Identities = 44/60 (73%), Positives = 55/60 (91%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVE+VYL K L IPM EVSV+W+EI GSKVR+TSI+HM+FEL+LI++GYGLG+WKI+ Sbjct: 291 WCFDVEIVYLCKHLRIPMAEVSVSWTEIPGSKVRMTSILHMVFELLLIKVGYGLGIWKIY 350 >ref|XP_002961154.1| hypothetical protein SELMODRAFT_73379 [Selaginella moellendorffii] gi|300172093|gb|EFJ38693.1| hypothetical protein SELMODRAFT_73379 [Selaginella moellendorffii] Length = 338 Score = 99.8 bits (247), Expect = 6e-19 Identities = 42/60 (70%), Positives = 53/60 (88%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVEL+YL K L IP +E++VNW+EI GSK+R+TSI+HMLFEL+LIR+GYG +WKIH Sbjct: 272 WCFDVELLYLCKRLGIPALEIAVNWTEIPGSKLRMTSILHMLFELLLIRIGYGFNVWKIH 331 >ref|XP_002966855.1| hypothetical protein SELMODRAFT_168631 [Selaginella moellendorffii] gi|300164846|gb|EFJ31454.1| hypothetical protein SELMODRAFT_168631 [Selaginella moellendorffii] Length = 342 Score = 99.8 bits (247), Expect = 6e-19 Identities = 42/60 (70%), Positives = 53/60 (88%) Frame = -3 Query: 387 WCFDVELVYLSKCLNIPMIEVSVNWSEIAGSKVRLTSIMHMLFELVLIRLGYGLGLWKIH 208 WCFDVEL+YL K L IP +E++VNW+EI GSK+R+TSI+HMLFEL+LIR+GYG +WKIH Sbjct: 276 WCFDVELLYLCKRLGIPALEIAVNWTEIPGSKLRMTSILHMLFELLLIRIGYGFNVWKIH 335