BLASTX nr result
ID: Cinnamomum25_contig00012898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00012898 (413 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010684484.1| PREDICTED: protein pleiotropic regulatory lo... 66 3e-18 ref|XP_002516938.1| PP1/PP2A phosphatases pleiotropic regulator ... 66 3e-18 gb|KDO71702.1| hypothetical protein CISIN_1g011457mg [Citrus sin... 65 5e-18 ref|XP_006489059.1| PREDICTED: protein pleiotropic regulatory lo... 65 5e-18 ref|XP_006419550.1| hypothetical protein CICLE_v10004853mg [Citr... 65 5e-18 ref|XP_004296851.1| PREDICTED: protein pleiotropic regulatory lo... 65 8e-18 ref|XP_006339555.1| PREDICTED: protein pleiotropic regulatory lo... 65 1e-17 ref|XP_002262991.2| PREDICTED: protein pleiotropic regulatory lo... 64 1e-17 ref|XP_008458420.1| PREDICTED: protein pleiotropic regulatory lo... 64 1e-17 ref|XP_004150502.1| PREDICTED: protein pleiotropic regulatory lo... 64 1e-17 ref|XP_012083957.1| PREDICTED: protein pleiotropic regulatory lo... 63 2e-17 ref|XP_012843716.1| PREDICTED: protein pleiotropic regulatory lo... 65 2e-17 ref|XP_008390645.1| PREDICTED: protein pleiotropic regulatory lo... 64 2e-17 ref|XP_012843717.1| PREDICTED: protein pleiotropic regulatory lo... 65 2e-17 ref|XP_004229892.1| PREDICTED: protein pleiotropic regulatory lo... 65 3e-17 ref|XP_010259551.1| PREDICTED: protein pleiotropic regulatory lo... 62 4e-17 ref|XP_010269564.1| PREDICTED: protein pleiotropic regulatory lo... 62 4e-17 ref|XP_009763088.1| PREDICTED: protein pleiotropic regulatory lo... 65 4e-17 ref|XP_009596265.1| PREDICTED: protein pleiotropic regulatory lo... 65 4e-17 ref|XP_011092075.1| PREDICTED: protein pleiotropic regulatory lo... 64 5e-17 >ref|XP_010684484.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Beta vulgaris subsp. vulgaris] gi|731346494|ref|XP_010684485.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Beta vulgaris subsp. vulgaris] gi|870854143|gb|KMT05948.1| hypothetical protein BVRB_7g164380 [Beta vulgaris subsp. vulgaris] Length = 479 Score = 65.9 bits (159), Expect(2) = 3e-18 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL+FKPPKD+RRF Sbjct: 448 ADKTIKMWKEDETATPETHPLNFKPPKDIRRF 479 Score = 52.4 bits (124), Expect(2) = 3e-18 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 420 VQPGSLDSEAGIYALSYDLTGSRLVTCEAD 449 >ref|XP_002516938.1| PP1/PP2A phosphatases pleiotropic regulator PRL1, putative [Ricinus communis] gi|223544026|gb|EEF45552.1| PP1/PP2A phosphatases pleiotropic regulator PRL1, putative [Ricinus communis] Length = 415 Score = 65.9 bits (159), Expect(2) = 3e-18 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL+FKPPKD+RRF Sbjct: 384 ADKTIKMWKEDETATPETHPLNFKPPKDIRRF 415 Score = 52.4 bits (124), Expect(2) = 3e-18 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 356 VQPGSLDSEAGIYALSYDITGSRLVTCEAD 385 >gb|KDO71702.1| hypothetical protein CISIN_1g011457mg [Citrus sinensis] Length = 485 Score = 64.7 bits (156), Expect(2) = 5e-18 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMW++DETATPE+HPL+FKPPKD+RRF Sbjct: 454 ADKTIKMWREDETATPETHPLNFKPPKDIRRF 485 Score = 52.8 bits (125), Expect(2) = 5e-18 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 426 VQPGSLDSEAGIYALSYDVTGSRLVTCEAD 455 >ref|XP_006489059.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Citrus sinensis] Length = 485 Score = 64.7 bits (156), Expect(2) = 5e-18 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMW++DETATPE+HPL+FKPPKD+RRF Sbjct: 454 ADKTIKMWREDETATPETHPLNFKPPKDIRRF 485 Score = 52.8 bits (125), Expect(2) = 5e-18 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 426 VQPGSLDSEAGIYALSYDVTGSRLVTCEAD 455 >ref|XP_006419550.1| hypothetical protein CICLE_v10004853mg [Citrus clementina] gi|557521423|gb|ESR32790.1| hypothetical protein CICLE_v10004853mg [Citrus clementina] Length = 485 Score = 64.7 bits (156), Expect(2) = 5e-18 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMW++DETATPE+HPL+FKPPKD+RRF Sbjct: 454 ADKTIKMWREDETATPETHPLNFKPPKDIRRF 485 Score = 52.8 bits (125), Expect(2) = 5e-18 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 426 VQPGSLDSEAGIYALSYDVTGSRLVTCEAD 455 >ref|XP_004296851.1| PREDICTED: protein pleiotropic regulatory locus 1 [Fragaria vesca subsp. vesca] Length = 481 Score = 65.1 bits (157), Expect(2) = 8e-18 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWKQDE ATPE+HPL+FKPPKD+RRF Sbjct: 450 ADKTIKMWKQDENATPETHPLNFKPPKDIRRF 481 Score = 51.6 bits (122), Expect(2) = 8e-18 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLV+CE D Sbjct: 422 VQPGSLDSEAGIYALSYDVTGTRLVSCEAD 451 >ref|XP_006339555.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Solanum tuberosum] Length = 484 Score = 65.1 bits (157), Expect(2) = 1e-17 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL FKPPKD+RRF Sbjct: 453 ADKTIKMWKEDETATPETHPLHFKPPKDIRRF 484 Score = 51.2 bits (121), Expect(2) = 1e-17 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YAL+Y ATG RL++CE D Sbjct: 425 VQPGSLDSEAGIYALTYDATGSRLISCEAD 454 >ref|XP_002262991.2| PREDICTED: protein pleiotropic regulatory locus 1 [Vitis vinifera] gi|296083362|emb|CBI22998.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 63.9 bits (154), Expect(2) = 1e-17 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DE ATPE+HPL+FKPPKD+RRF Sbjct: 453 ADKTIKMWKEDENATPETHPLNFKPPKDIRRF 484 Score = 52.4 bits (124), Expect(2) = 1e-17 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 425 VQPGSLDSEAGIYALSYDLTGSRLVTCEAD 454 >ref|XP_008458420.1| PREDICTED: protein pleiotropic regulatory locus 1 [Cucumis melo] gi|659117098|ref|XP_008458421.1| PREDICTED: protein pleiotropic regulatory locus 1 [Cucumis melo] Length = 483 Score = 63.9 bits (154), Expect(2) = 1e-17 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DE ATPE+HPL+FKPPKD+RRF Sbjct: 452 ADKTIKMWKEDENATPETHPLNFKPPKDIRRF 483 Score = 52.4 bits (124), Expect(2) = 1e-17 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 424 VQPGSLDSEAGIYALSYDITGSRLVTCEAD 453 >ref|XP_004150502.1| PREDICTED: protein pleiotropic regulatory locus 1 [Cucumis sativus] gi|700192229|gb|KGN47433.1| hypothetical protein Csa_6G319790 [Cucumis sativus] Length = 476 Score = 63.9 bits (154), Expect(2) = 1e-17 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DE ATPE+HPL+FKPPKD+RRF Sbjct: 445 ADKTIKMWKEDENATPETHPLNFKPPKDIRRF 476 Score = 52.0 bits (123), Expect(2) = 1e-17 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RL+TCE D Sbjct: 417 VQPGSLDSEAGIYALSYDITGSRLITCEAD 446 >ref|XP_012083957.1| PREDICTED: protein pleiotropic regulatory locus 1 isoform X1 [Jatropha curcas] gi|802701535|ref|XP_012083958.1| PREDICTED: protein pleiotropic regulatory locus 1 isoform X2 [Jatropha curcas] gi|802701544|ref|XP_012083959.1| PREDICTED: protein pleiotropic regulatory locus 1 isoform X3 [Jatropha curcas] gi|643716038|gb|KDP27811.1| hypothetical protein JCGZ_18891 [Jatropha curcas] Length = 484 Score = 63.2 bits (152), Expect(2) = 2e-17 Identities = 24/32 (75%), Positives = 32/32 (100%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+D++ATPE+HPL+FKPPKD+RRF Sbjct: 453 ADKTIKMWKEDDSATPETHPLNFKPPKDIRRF 484 Score = 52.0 bits (123), Expect(2) = 2e-17 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YA+SY TG RLVTCE D Sbjct: 425 VQPGSLDSEAGIYAISYDVTGSRLVTCEAD 454 >ref|XP_012843716.1| PREDICTED: protein pleiotropic regulatory locus 1 isoform X1 [Erythranthe guttatus] gi|604321532|gb|EYU32108.1| hypothetical protein MIMGU_mgv1a005488mg [Erythranthe guttata] Length = 482 Score = 65.1 bits (157), Expect(2) = 2e-17 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPESHP+ FKPPKD+RRF Sbjct: 451 ADKTIKMWKEDETATPESHPVHFKPPKDIRRF 482 Score = 50.1 bits (118), Expect(2) = 2e-17 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YA++Y TG RL+TCE D Sbjct: 423 VQPGSLDSEAGIYAITYDLTGSRLITCEAD 452 >ref|XP_008390645.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Malus domestica] gi|658062489|ref|XP_008367145.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Malus domestica] Length = 480 Score = 63.9 bits (154), Expect(2) = 2e-17 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWKQDE ATPE+HPL+F+PPKD+RRF Sbjct: 449 ADKTIKMWKQDENATPETHPLNFRPPKDIRRF 480 Score = 51.2 bits (121), Expect(2) = 2e-17 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLV+CE D Sbjct: 421 VQPGSLDSEAGIYALSYDITGTRLVSCEAD 450 >ref|XP_012843717.1| PREDICTED: protein pleiotropic regulatory locus 1 isoform X2 [Erythranthe guttatus] Length = 434 Score = 65.1 bits (157), Expect(2) = 2e-17 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPESHP+ FKPPKD+RRF Sbjct: 403 ADKTIKMWKEDETATPESHPVHFKPPKDIRRF 434 Score = 50.1 bits (118), Expect(2) = 2e-17 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YA++Y TG RL+TCE D Sbjct: 375 VQPGSLDSEAGIYAITYDLTGSRLITCEAD 404 >ref|XP_004229892.1| PREDICTED: protein pleiotropic regulatory locus 1 [Solanum lycopersicum] Length = 482 Score = 65.1 bits (157), Expect(2) = 3e-17 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL FKPPKD+RRF Sbjct: 451 ADKTIKMWKEDETATPETHPLHFKPPKDIRRF 482 Score = 49.7 bits (117), Expect(2) = 3e-17 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YAL+Y TG RL++CE D Sbjct: 423 VQPGSLDSEAGIYALTYDVTGSRLISCEAD 452 >ref|XP_010259551.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Nelumbo nucifera] Length = 487 Score = 62.0 bits (149), Expect(2) = 4e-17 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DE A PE+HPL+FKPPKD+RRF Sbjct: 456 ADKTIKMWKEDENANPETHPLNFKPPKDIRRF 487 Score = 52.4 bits (124), Expect(2) = 4e-17 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 428 VQPGSLDSEAGIYALSYDITGSRLVTCEAD 457 >ref|XP_010269564.1| PREDICTED: protein pleiotropic regulatory locus 1 [Nelumbo nucifera] Length = 485 Score = 62.0 bits (149), Expect(2) = 4e-17 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DE ATPE+HP++FKPPKD+RRF Sbjct: 454 ADKTIKMWKEDENATPETHPVNFKPPKDLRRF 485 Score = 52.4 bits (124), Expect(2) = 4e-17 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YALSY TG RLVTCE D Sbjct: 426 VQPGSLDSEAGIYALSYDITGSRLVTCEAD 455 >ref|XP_009763088.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana sylvestris] Length = 483 Score = 65.1 bits (157), Expect(2) = 4e-17 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL FKPPKD+RRF Sbjct: 452 ADKTIKMWKEDETATPETHPLHFKPPKDIRRF 483 Score = 49.3 bits (116), Expect(2) = 4e-17 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YAL+Y TG RL++CE D Sbjct: 424 VQPGSLDSEAGIYALTYDMTGSRLISCEAD 453 >ref|XP_009596265.1| PREDICTED: protein pleiotropic regulatory locus 1-like [Nicotiana tomentosiformis] Length = 483 Score = 65.1 bits (157), Expect(2) = 4e-17 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL FKPPKD+RRF Sbjct: 452 ADKTIKMWKEDETATPETHPLHFKPPKDIRRF 483 Score = 49.3 bits (116), Expect(2) = 4e-17 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YAL+Y TG RL++CE D Sbjct: 424 VQPGSLDSEAGIYALTYDMTGSRLISCEAD 453 >ref|XP_011092075.1| PREDICTED: protein pleiotropic regulatory locus 1 [Sesamum indicum] Length = 486 Score = 63.9 bits (154), Expect(2) = 5e-17 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 332 ANKTVKMWKQDETATPESHPLSFKPPKDVRRF 237 A+KT+KMWK+DETATPE+HPL FKPP+D+RRF Sbjct: 455 ADKTIKMWKEDETATPETHPLHFKPPRDIRRF 486 Score = 50.1 bits (118), Expect(2) = 5e-17 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 411 VQPGSLDSEAGLYALSYLATGLRLVTCEQD 322 VQPGSLDSEAG+YA++Y TG RL+TCE D Sbjct: 427 VQPGSLDSEAGIYAITYDLTGSRLITCEAD 456