BLASTX nr result
ID: Cinnamomum25_contig00012604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00012604 (474 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001312226.1| hypothetical protein CYtaCp060 [Cycas taitun... 80 7e-13 ref|YP_009141970.1| photosystem I reaction center subunit IX (ch... 75 2e-11 ref|YP_009139121.1| photosystem I subunit IX (chloroplast) [Dios... 75 2e-11 gb|AHH24294.1| photosystem I protein J (chloroplast) [Japonoliri... 75 2e-11 ref|YP_006503709.1| photosystem I subunit IX (chloroplast) [Eryc... 75 2e-11 ref|YP_009048594.1| photosystem I reaction center subunit IX [Pa... 75 2e-11 gb|AEX95830.1| photosystem I subunit IX (chloroplast) [Crinum as... 75 2e-11 gb|AEX95828.1| photosystem I subunit IX (chloroplast) [Tulbaghia... 75 2e-11 ref|YP_009026457.1| photosystem I subunit IX (chloroplast) [Dend... 75 2e-11 gb|AEX95819.1| photosystem I subunit IX (chloroplast) [Anemarrhe... 75 2e-11 ref|YP_009093820.1| photosystem I subunit IX (chloroplast) [Luzu... 74 3e-11 ref|YP_009048219.1| photosystem I reaction center subunit IX (ch... 74 3e-11 gb|KMS64504.1| hypothetical protein BVRB_019610 [Beta vulgaris s... 69 4e-11 gb|EPS74397.1| hypothetical protein M569_00360, partial [Genlise... 74 4e-11 ref|YP_009129551.1| photosystem I reaction center subunit IX (ch... 74 5e-11 ref|YP_009130062.1| photosystem I subunit IX (chloroplast) [Camp... 74 5e-11 ref|YP_009122607.1| photosystem I subunit IX (chloroplast) [Masd... 74 5e-11 ref|YP_009109297.1| photosystem I subunit IX [Corallorhiza odont... 74 5e-11 ref|YP_009109080.1| photosystem I subunit IX [Corallorhiza merte... 74 5e-11 ref|YP_009045586.1| photosystem I subunit IX (chloroplast) [Cypr... 74 5e-11 >ref|YP_001312226.1| hypothetical protein CYtaCp060 [Cycas taitungensis] gi|149941543|dbj|BAF64967.1| hypothetical protein (chloroplast) [Cycas taitungensis] Length = 77 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -1 Query: 450 RRIFNARYKNISLHGTCANYSMVRVFGGSIDRDQSFIPRCVDIPLFFILVI 298 R+ +NARYK+IS H CA+Y MVRVFG SIDRDQSF PRC D LFFILV+ Sbjct: 2 RKTYNARYKDISFHSACASYFMVRVFGRSIDRDQSFFPRCFDFSLFFILVL 52 >ref|YP_009141970.1| photosystem I reaction center subunit IX (chloroplast) [Heloniopsis tubiflora] gi|705244349|gb|AIW56524.1| photosystem I reaction center subunit IX (chloroplast) [Heloniopsis tubiflora] Length = 46 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009139121.1| photosystem I subunit IX (chloroplast) [Dioscorea zingiberensis] gi|817161693|gb|AKF33675.1| photosystem I subunit IX (chloroplast) [Dioscorea zingiberensis] Length = 44 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >gb|AHH24294.1| photosystem I protein J (chloroplast) [Japonolirion osense] Length = 46 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_006503709.1| photosystem I subunit IX (chloroplast) [Erycina pusilla] gi|511943397|ref|YP_008081670.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium sinense] gi|511943510|ref|YP_008081826.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium tracyanum] gi|520850547|ref|YP_008081592.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium aloifolium] gi|724137224|ref|YP_009109017.1| photosystem I subunit IX [Corallorhiza macrantha] gi|725676331|ref|YP_009109224.1| photosystem I subunit IX [Corallorhiza wisteriana] gi|745999041|ref|YP_009108945.1| photosystem I subunit IX [Corallorhiza bulbosa] gi|788366099|ref|YP_009123452.1| photosystem I reaction center subunit IX (chloroplast) [Cattleya crispata] gi|339431321|gb|AEJ72515.1| photosystem I subunit IX (chloroplast) [Erycina pusilla] gi|482662068|gb|AGK25297.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium aloifolium] gi|482662147|gb|AGK25375.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium sinense] gi|482662305|gb|AGK25531.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium tortisepalum] gi|482662463|gb|AGK25687.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium tracyanum] gi|704001105|gb|AIW51224.1| photosystem I subunit IX [Corallorhiza bulbosa] gi|704001237|gb|AIW51354.1| photosystem I subunit IX [Corallorhiza maculata var. mexicana] gi|704001371|gb|AIW51486.1| photosystem I subunit IX [Corallorhiza macrantha] gi|704001581|gb|AIW51693.1| photosystem I subunit IX [Corallorhiza wisteriana] gi|756762333|gb|AJM70424.1| photosystem I reaction center subunit IX (chloroplast) [Cattleya crispata] Length = 44 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009048594.1| photosystem I reaction center subunit IX [Paris verticillata] gi|712911717|ref|YP_009092702.1| photosystem I reaction center subunit IX [Eustrephus latifolius] gi|810932452|ref|YP_009129364.1| photosystem I reaction center subunit IX (chloroplast) [Cypripedium formosanum] gi|810932559|ref|YP_009129451.1| photosystem I reaction center subunit IX (chloroplast) [Goodyera fumata] gi|827045551|ref|YP_009141883.1| photosystem I reaction center subunit IX (chloroplast) [Xerophyllum tenax] gi|827046290|ref|YP_009142591.1| photosystem I reaction center subunit IX (plastid) [Trillium cuneatum] gi|836614333|ref|YP_009144794.1| photosystem I subunit IX (chloroplast) [Elleanthus sodiroi] gi|836642906|ref|YP_009143909.1| photosystem I subunit IX (plastid) [Cypripedium japonicum] gi|836643863|ref|YP_009145280.1| photosystem I reaction center subunit IX (plastid) [Trillium decumbens] gi|372484384|gb|AEX95833.1| photosystem I subunit IX (chloroplast) [Aphyllanthes monspeliensis] gi|372484404|gb|AEX95843.1| photosystem I subunit IX (chloroplast) [Bowiea volubilis] gi|372484406|gb|AEX95844.1| photosystem I subunit IX (chloroplast) [Drimia altissima] gi|372484408|gb|AEX95845.1| photosystem I subunit IX (chloroplast) [Ledebouria cordifolia] gi|372484410|gb|AEX95846.1| photosystem I subunit IX (chloroplast) [Ornithogalum tenuifolium] gi|372484412|gb|AEX95847.1| photosystem I subunit IX (chloroplast) [Oziroe biflora] gi|372484418|gb|AEX95850.1| photosystem I subunit IX (chloroplast) [Trichopetalum plumosum] gi|372484436|gb|AEX95859.1| photosystem I subunit IX (chloroplast) [Androstephium coeruleum] gi|372484438|gb|AEX95860.1| photosystem I subunit IX (chloroplast) [Brodiaea californica] gi|372484440|gb|AEX95861.1| photosystem I subunit IX (chloroplast) [Dichelostemma capitatum] gi|372484442|gb|AEX95862.1| photosystem I subunit IX (chloroplast) [Dichelostemma congestum] gi|372484444|gb|AEX95863.1| photosystem I subunit IX (chloroplast) [Dichelostemma ida-maia] gi|372484446|gb|AEX95864.1| photosystem I subunit IX (chloroplast) [Triteleia hyacinthina] gi|372484450|gb|AEX95866.1| photosystem I subunit IX (chloroplast) [Xeronema callistemon] gi|374974389|gb|AFA27290.1| photosystem I subunit IX [Albuca kirkii] gi|374974391|gb|AFA27291.1| photosystem I subunit IX, partial [Apostasia wallichii] gi|584297201|gb|AHI87547.1| photosystem I reaction center subunit IX (chloroplast) [Chionographis japonica] gi|618625604|gb|AHX80470.1| photosystem I reaction center subunit IX [Paris verticillata] gi|632812730|gb|AHZ42960.1| photosystem I reaction center subunit IX (chloroplast) [Cypripedium formosanum] gi|632812818|gb|AHZ43047.1| photosystem I reaction center subunit IX (chloroplast) [Goodyera fumata] gi|648933356|gb|AIC37294.1| photosystem I subunit IX [Cypripedium japonicum] gi|690196766|gb|AIR12538.1| photosystem I reaction center subunit IX [Eustrephus latifolius] gi|705244242|gb|AIW56437.1| photosystem I reaction center subunit IX (chloroplast) [Xerophyllum tenax] gi|821608277|gb|AKH59853.1| photosystem I reaction center subunit IX (plastid) [Trillium cuneatum] gi|827346195|gb|AKJ77401.1| photosystem I subunit IX (chloroplast) [Elleanthus sodiroi] gi|828348699|gb|AKK32160.1| photosystem I reaction center subunit IX (plastid) [Trillium decumbens] Length = 44 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >gb|AEX95830.1| photosystem I subunit IX (chloroplast) [Crinum asiaticum] gi|372484416|gb|AEX95849.1| photosystem I subunit IX (chloroplast) [Cordyline australis] gi|372484432|gb|AEX95857.1| photosystem I subunit IX (chloroplast) [Sansevieria trifasciata] Length = 45 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >gb|AEX95828.1| photosystem I subunit IX (chloroplast) [Tulbaghia violacea] Length = 44 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009026457.1| photosystem I subunit IX (chloroplast) [Dendrobium catenatum] gi|695101522|ref|YP_009057171.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|697964909|ref|YP_009059539.1| photosystem I subunit IX [Iris gatesii] gi|712911819|ref|YP_009092787.1| photosystem I reaction center subunit IX [Bomarea edulis] gi|806636709|ref|YP_009129635.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum niveum] gi|814072119|ref|YP_009129872.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum armeniacum] gi|372484368|gb|AEX95825.1| photosystem I subunit IX (chloroplast) [Allium fistulosum] gi|372484370|gb|AEX95826.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|372484386|gb|AEX95834.1| photosystem I subunit IX (chloroplast) [Asparagus officinalis] gi|372484388|gb|AEX95835.1| photosystem I subunit IX (chloroplast) [Asparagus asparagoides] gi|372484390|gb|AEX95836.1| photosystem I subunit IX (chloroplast) [Hemiphylacus alatostylus] gi|372484392|gb|AEX95837.1| photosystem I subunit IX (chloroplast) [Aloe vera] gi|372484396|gb|AEX95839.1| photosystem I subunit IX (chloroplast) [Haworthia cymbiformis] gi|372484398|gb|AEX95840.1| photosystem I subunit IX (chloroplast) [Kniphofia linearifolia] gi|372484400|gb|AEX95841.1| photosystem I subunit IX (chloroplast) [Doryanthes palmeri] gi|372484420|gb|AEX95851.1| photosystem I subunit IX (chloroplast) [Beaucarnea hookeri] gi|372484422|gb|AEX95852.1| photosystem I subunit IX (chloroplast) [Dasylirion wheeleri] gi|372484424|gb|AEX95853.1| photosystem I subunit IX (chloroplast) [Eriospermum cervicorne] gi|372484426|gb|AEX95854.1| photosystem I subunit IX (chloroplast) [Liriope spicata] gi|372484428|gb|AEX95855.1| photosystem I subunit IX (chloroplast) [Ophiopogon japonicus] gi|372484430|gb|AEX95856.1| photosystem I subunit IX (chloroplast) [Ruscus aculeatus] gi|372484434|gb|AEX95858.1| photosystem I subunit IX (chloroplast) [Maianthemum stellatum] gi|372484448|gb|AEX95865.1| photosystem I subunit IX (chloroplast) [Xanthorrhoea preissii] gi|374974393|gb|AFA27292.1| photosystem I subunit IX [Asparagus officinalis] gi|374974423|gb|AFA27307.1| photosystem I subunit IX [Iris virginica] gi|374974437|gb|AFA27314.1| photosystem I subunit IX, partial [Neoastelia spectabilis] gi|374974441|gb|AFA27316.1| photosystem I subunit IX, partial [Nolina atopocarpa] gi|507474339|gb|AGM48215.1| photosystem I subunit IX (chloroplast) [Dendrobium catenatum] gi|567767881|gb|AHC94607.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|567767963|gb|AHC94688.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|655167112|gb|AIC82626.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum niveum] gi|657406534|gb|AID52251.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum armeniacum] gi|685161422|gb|AIN79066.1| photosystem I subunit IX [Iris gatesii] gi|690196862|gb|AIR12623.1| photosystem I reaction center subunit IX [Bomarea edulis] gi|691192167|gb|AIR76426.1| photosystem I subunit IX (chloroplast) [Dendrobium catenatum] Length = 42 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >gb|AEX95819.1| photosystem I subunit IX (chloroplast) [Anemarrhena asphodeloides] gi|372484372|gb|AEX95827.1| photosystem I subunit IX (chloroplast) [Gilliesia graminea] gi|372484376|gb|AEX95829.1| photosystem I subunit IX (chloroplast) [Amaryllis belladonna] gi|372484380|gb|AEX95831.1| photosystem I subunit IX (chloroplast) [Eucharis x grandiflora] gi|372484382|gb|AEX95832.1| photosystem I subunit IX (chloroplast) [Scadoxus cinnabarinus] Length = 44 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009093820.1| photosystem I subunit IX (chloroplast) [Luzuriaga radicans] gi|695277435|gb|AIT16012.1| photosystem I subunit IX (chloroplast) [Luzuriaga radicans] Length = 42 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRD+KTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDLKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009048219.1| photosystem I reaction center subunit IX (chloroplast) [Calanthe triplicata] gi|573015309|gb|AHF71890.1| photosystem I reaction center subunit IX (chloroplast) [Calanthe triplicata] Length = 44 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPV+TTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVITTLWFGSLAGLLIEINRLFPDA 36 >gb|KMS64504.1| hypothetical protein BVRB_019610 [Beta vulgaris subsp. vulgaris] Length = 63 Score = 68.6 bits (166), Expect(2) = 4e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRD KTYLS APVL+TLWFGSLAGLLIEINR FPDA Sbjct: 1 MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDA 36 Score = 25.8 bits (55), Expect(2) = 4e-11 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 345 FIPRCVDIPLFFILVIDMGRDQED*RYN 262 F P + P FFILVID R ++ +N Sbjct: 32 FFPDALTFPFFFILVIDTRRVKKKSGFN 59 >gb|EPS74397.1| hypothetical protein M569_00360, partial [Genlisea aurea] Length = 67 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 452 EGGFSMRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 +G FSMRD+KTYLS APVL+TLWFG LAGLLIEINR FPDA Sbjct: 19 QGAFSMRDLKTYLSVAPVLSTLWFGLLAGLLIEINRFFPDA 59 >ref|YP_009129551.1| photosystem I reaction center subunit IX (chloroplast) [Habenaria pantlingiana] gi|655167037|gb|AIC82552.1| photosystem I reaction center subunit IX (chloroplast) [Habenaria pantlingiana] Length = 52 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 M+DIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MQDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009130062.1| photosystem I subunit IX (chloroplast) [Campynema lineare] gi|768803730|gb|AJV88531.1| photosystem I subunit IX (chloroplast) [Campynema lineare] Length = 46 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSL GLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLGGLLIEINRLFPDA 36 >ref|YP_009122607.1| photosystem I subunit IX (chloroplast) [Masdevallia coccinea] gi|806636797|ref|YP_009129713.1| photosystem I reaction center subunit IX (chloroplast) [Masdevallia picturata] gi|657406380|gb|AID52099.1| photosystem I reaction center subunit IX (chloroplast) [Masdevallia picturata] gi|755161323|gb|AJJ48575.1| photosystem I subunit IX (chloroplast) [Masdevallia coccinea] Length = 44 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINR FPDA Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRFFPDA 36 >ref|YP_009109297.1| photosystem I subunit IX [Corallorhiza odontorhiza] gi|704001655|gb|AIW51766.1| photosystem I subunit IX [Corallorhiza odontorhiza] Length = 44 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLST PVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTVPVLTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009109080.1| photosystem I subunit IX [Corallorhiza mertensiana] gi|704001170|gb|AIW51288.1| photosystem I subunit IX [Corallorhiza maculata var. maculata] gi|704001301|gb|AIW51417.1| photosystem I subunit IX [Corallorhiza maculata var. occidentalis] gi|704001435|gb|AIW51549.1| photosystem I subunit IX [Corallorhiza mertensiana] Length = 44 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 MRDIKTYLSTAP LTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MRDIKTYLSTAPALTTLWFGSLAGLLIEINRLFPDA 36 >ref|YP_009045586.1| photosystem I subunit IX (chloroplast) [Cypripedium macranthos] gi|69217666|gb|AAZ04098.1| photosystem I subunit IX [Yucca schidigera] gi|372484358|gb|AEX95820.1| photosystem I subunit IX (chloroplast) [Camassia scilloides] gi|372484362|gb|AEX95822.1| photosystem I subunit IX (chloroplast) [Hosta ventricosa] gi|372484366|gb|AEX95824.1| photosystem I subunit IX (chloroplast) [Polianthes sp. Pires 2011-05] gi|374974419|gb|AFA27305.1| photosystem I subunit IX, partial [Hesperaloe parviflora] gi|374974421|gb|AFA27306.1| photosystem I subunit IX, partial [Hosta ventricosa] gi|578888886|gb|AHI16769.1| photosystem I subunit IX (chloroplast) (chloroplast) [Cypripedium macranthos] Length = 44 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 437 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 330 M+DIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA Sbjct: 1 MQDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDA 36