BLASTX nr result
ID: Cinnamomum25_contig00012523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00012523 (400 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containin... 70 4e-10 ref|XP_010647505.1| PREDICTED: katanin p80 WD40 repeat-containin... 70 4e-10 ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containin... 70 4e-10 emb|CBI35743.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_012449467.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 9e-10 ref|XP_012449466.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 9e-10 ref|XP_012449464.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 9e-10 ref|XP_012449465.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 9e-10 gb|KJB68607.1| hypothetical protein B456_010G254700 [Gossypium r... 69 9e-10 gb|KJB68606.1| hypothetical protein B456_010G254700 [Gossypium r... 69 9e-10 ref|XP_010521766.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 9e-10 ref|XP_012091537.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 1e-09 ref|XP_012091536.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 1e-09 ref|XP_012091535.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 1e-09 ref|XP_011043253.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 2e-09 ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 2e-09 ref|XP_009392416.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 2e-09 ref|XP_009392408.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 2e-09 ref|XP_002521412.1| katanin P80 subunit, putative [Ricinus commu... 69 2e-09 ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Popu... 69 2e-09 >ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Vitis vinifera] Length = 806 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 V+LQAE RR C QCF+QLQKI++ LP +IRRGGLLAK A ELNL +QE Sbjct: 757 VNLQAEHRRECCNQCFIQLQKIQKNLPVIIRRGGLLAKSAQELNLVLQE 805 >ref|XP_010647505.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Vitis vinifera] Length = 542 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 V+LQAE RR C QCF+QLQKI++ LP +IRRGGLLAK A ELNL +QE Sbjct: 493 VNLQAEHRRECCNQCFIQLQKIQKNLPVIIRRGGLLAKSAQELNLVLQE 541 >ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Nelumbo nucifera] Length = 786 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VD+QAE RR C QCF+QLQKIKQ+LP+V RRGGL+AK A EL+L +QE Sbjct: 737 VDIQAEHRRECCKQCFLQLQKIKQVLPTVTRRGGLIAKCAEELHLVLQE 785 >emb|CBI35743.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 V+LQAE RR C QCF+QLQKI++ LP +IRRGGLLAK A ELNL +QE Sbjct: 265 VNLQAEHRRECCNQCFIQLQKIQKNLPVIIRRGGLLAKSAQELNLVLQE 313 >ref|XP_012449467.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X4 [Gossypium raimondii] Length = 822 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C QCF+QLQKI++LLP ++RRGG +A+ A ELNL++QE Sbjct: 774 VDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGGTIARGAQELNLALQE 822 >ref|XP_012449466.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Gossypium raimondii] Length = 836 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C QCF+QLQKI++LLP ++RRGG +A+ A ELNL++QE Sbjct: 788 VDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGGTIARGAQELNLALQE 836 >ref|XP_012449464.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Gossypium raimondii] gi|763801654|gb|KJB68609.1| hypothetical protein B456_010G254700 [Gossypium raimondii] Length = 927 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C QCF+QLQKI++LLP ++RRGG +A+ A ELNL++QE Sbjct: 879 VDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGGTIARGAQELNLALQE 927 >ref|XP_012449465.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Gossypium raimondii] gi|763801653|gb|KJB68608.1| hypothetical protein B456_010G254700 [Gossypium raimondii] Length = 926 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C QCF+QLQKI++LLP ++RRGG +A+ A ELNL++QE Sbjct: 878 VDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGGTIARGAQELNLALQE 926 >gb|KJB68607.1| hypothetical protein B456_010G254700 [Gossypium raimondii] Length = 821 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C QCF+QLQKI++LLP ++RRGG +A+ A ELNL++QE Sbjct: 773 VDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGGTIARGAQELNLALQE 821 >gb|KJB68606.1| hypothetical protein B456_010G254700 [Gossypium raimondii] Length = 835 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C QCF+QLQKI++LLP ++RRGG +A+ A ELNL++QE Sbjct: 787 VDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGGTIARGAQELNLALQE 835 >ref|XP_010521766.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Tarenaya hassleriana] gi|729301563|ref|XP_010521774.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Tarenaya hassleriana] Length = 841 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VD++AE+R C++CFV+L+K+K LPS++RRGGL+AK A ELNLS QE Sbjct: 791 VDIEAEQRMERCSRCFVELEKVKACLPSLVRRGGLVAKSATELNLSFQE 839 >ref|XP_012091537.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Jatropha curcas] Length = 850 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL E+R C QCFVQLQKI+Q+LP++IR+GGL+AK AMELNL +Q+ Sbjct: 801 VDLHQEQRLECCKQCFVQLQKIQQILPALIRKGGLVAKSAMELNLVLQQ 849 >ref|XP_012091536.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Jatropha curcas] Length = 936 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL E+R C QCFVQLQKI+Q+LP++IR+GGL+AK AMELNL +Q+ Sbjct: 887 VDLHQEQRLECCKQCFVQLQKIQQILPALIRKGGLVAKSAMELNLVLQQ 935 >ref|XP_012091535.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Jatropha curcas] gi|643703848|gb|KDP20912.1| hypothetical protein JCGZ_21383 [Jatropha curcas] Length = 941 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL E+R C QCFVQLQKI+Q+LP++IR+GGL+AK AMELNL +Q+ Sbjct: 892 VDLHQEQRLECCKQCFVQLQKIQQILPALIRKGGLVAKSAMELNLVLQQ 940 >ref|XP_011043253.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Populus euphratica] Length = 838 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C +CF QLQKI+Q+LP++ RRGGLL K A+ELNL +Q+ Sbjct: 789 VDLHAEQRRECCNKCFAQLQKIQQILPALARRGGLLTKSALELNLVLQQ 837 >ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Populus euphratica] Length = 959 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C +CF QLQKI+Q+LP++ RRGGLL K A+ELNL +Q+ Sbjct: 910 VDLHAEQRRECCNKCFAQLQKIQQILPALARRGGLLTKSALELNLVLQQ 958 >ref|XP_009392416.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Musa acuminata subsp. malaccensis] Length = 806 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDLQAE+R HCT CF L+KIKQ+LP +IRRGGLLAK A ELN+ +++ Sbjct: 757 VDLQAEQRLEHCTHCFNNLEKIKQVLPPLIRRGGLLAKHAGELNIILRD 805 >ref|XP_009392408.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Musa acuminata subsp. malaccensis] Length = 826 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDLQAE+R HCT CF L+KIKQ+LP +IRRGGLLAK A ELN+ +++ Sbjct: 777 VDLQAEQRLEHCTHCFNNLEKIKQVLPPLIRRGGLLAKHAGELNIILRD 825 >ref|XP_002521412.1| katanin P80 subunit, putative [Ricinus communis] gi|223539311|gb|EEF40902.1| katanin P80 subunit, putative [Ricinus communis] Length = 936 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 V+L AE+R C QCFVQLQKI+Q+LP++IR+GG+LAK A+ELNL +QE Sbjct: 887 VNLHAEQRLECCKQCFVQLQKIQQILPALIRKGGVLAKSAVELNLVLQE 935 >ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] gi|550327580|gb|ERP55104.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] Length = 990 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 351 VDLQAEERRNHCTQCFVQLQKIKQLLPSVIRRGGLLAKPAMELNLSIQE 205 VDL AE+RR C +CF QLQKI+Q+LP++ RRGGLL K A+ELNL +Q+ Sbjct: 941 VDLHAEQRRECCNKCFAQLQKIQQILPALARRGGLLTKSALELNLVLQQ 989