BLASTX nr result
ID: Cinnamomum25_contig00012287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00012287 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010272271.1| PREDICTED: glutathione S-transferase F10-lik... 57 5e-06 >ref|XP_010272271.1| PREDICTED: glutathione S-transferase F10-like [Nelumbo nucifera] Length = 211 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +1 Query: 136 MVVKVYGPVYASAARRVLACLIEKEVDFEIKPINII 243 MVVKV+GP YAS +RRVLACL+EKE++F+I P++++ Sbjct: 1 MVVKVHGPAYASCSRRVLACLVEKEIEFDIVPVDLL 36