BLASTX nr result
ID: Cinnamomum25_contig00012111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00012111 (480 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010243344.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 >ref|XP_010243344.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nelumbo nucifera] Length = 584 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 478 VMGDESHPRSEEIYKIVDQMANALKLEGYVATARDLLHD*YINEEKK 338 VMGD+SHP +EEIY+++DQM LK EGY +T D+LHD I+EE+K Sbjct: 465 VMGDDSHPETEEIYEMLDQMGRRLKQEGYASTTNDVLHD--IDEEEK 509