BLASTX nr result
ID: Cinnamomum25_contig00011830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00011830 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG23784.1| hypothetical protein F383_09701 [Gossypium arboreum] 58 1e-06 ref|XP_007051622.1| Nucleotide-sugar transporter family protein ... 58 2e-06 gb|KJB41478.1| hypothetical protein B456_007G106100 [Gossypium r... 58 3e-06 gb|KJB41477.1| hypothetical protein B456_007G106100 [Gossypium r... 58 3e-06 gb|KJB41476.1| hypothetical protein B456_007G106100 [Gossypium r... 58 3e-06 gb|KJB41475.1| hypothetical protein B456_007G106100 [Gossypium r... 58 3e-06 ref|XP_012490073.1| PREDICTED: CMP-sialic acid transporter 1-lik... 58 3e-06 ref|XP_012490070.1| PREDICTED: CMP-sialic acid transporter 1-lik... 58 3e-06 ref|XP_009349677.1| PREDICTED: CMP-sialic acid transporter 1-lik... 58 3e-06 ref|XP_009336251.1| PREDICTED: CMP-sialic acid transporter 1-lik... 58 3e-06 ref|XP_009352361.1| PREDICTED: CMP-sialic acid transporter 1-lik... 58 3e-06 ref|XP_009352360.1| PREDICTED: CMP-sialic acid transporter 1-lik... 58 3e-06 ref|XP_008392450.1| PREDICTED: CMP-sialic acid transporter 1 [Ma... 58 3e-06 ref|XP_012437742.1| PREDICTED: CMP-sialic acid transporter 1-lik... 57 5e-06 ref|XP_012437741.1| PREDICTED: CMP-sialic acid transporter 1-lik... 57 5e-06 ref|XP_011026932.1| PREDICTED: CMP-sialic acid transporter 1-lik... 57 5e-06 ref|XP_010553552.1| PREDICTED: CMP-sialic acid transporter 1 [Ta... 57 5e-06 gb|KHG29555.1| hypothetical protein F383_05304 [Gossypium arboreum] 57 5e-06 ref|XP_010261488.1| PREDICTED: CMP-sialic acid transporter 1 [Ne... 56 5e-06 ref|XP_008239073.1| PREDICTED: CMP-sialic acid transporter 1 [Pr... 57 6e-06 >gb|KHG23784.1| hypothetical protein F383_09701 [Gossypium arboreum] Length = 334 Score = 58.2 bits (139), Expect(2) = 1e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 221 GPWWQRLFNGYSITTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 265 Score = 20.4 bits (41), Expect(2) = 1e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 204 LYGFGAIFN 178 LY FGAIFN Sbjct: 197 LYTFGAIFN 205 >ref|XP_007051622.1| Nucleotide-sugar transporter family protein [Theobroma cacao] gi|508703883|gb|EOX95779.1| Nucleotide-sugar transporter family protein [Theobroma cacao] Length = 335 Score = 57.8 bits (138), Expect(2) = 2e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 266 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 204 LYGFGAIFN 178 LY FGAIFN Sbjct: 198 LYTFGAIFN 206 >gb|KJB41478.1| hypothetical protein B456_007G106100 [Gossypium raimondii] Length = 206 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 93 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 137 >gb|KJB41477.1| hypothetical protein B456_007G106100 [Gossypium raimondii] Length = 289 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >gb|KJB41476.1| hypothetical protein B456_007G106100 [Gossypium raimondii] Length = 271 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 158 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 202 >gb|KJB41475.1| hypothetical protein B456_007G106100 [Gossypium raimondii] Length = 291 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 178 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 222 >ref|XP_012490073.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X2 [Gossypium raimondii] gi|763774350|gb|KJB41473.1| hypothetical protein B456_007G106100 [Gossypium raimondii] Length = 278 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 165 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 209 >ref|XP_012490070.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Gossypium raimondii] gi|823187089|ref|XP_012490071.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Gossypium raimondii] gi|823187092|ref|XP_012490072.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Gossypium raimondii] gi|763774349|gb|KJB41472.1| hypothetical protein B456_007G106100 [Gossypium raimondii] gi|763774351|gb|KJB41474.1| hypothetical protein B456_007G106100 [Gossypium raimondii] Length = 335 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T WMV+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSVTTWMVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_009349677.1| PREDICTED: CMP-sialic acid transporter 1-like [Pyrus x bretschneideri] Length = 335 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYSLT W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSLTTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_009336251.1| PREDICTED: CMP-sialic acid transporter 1-like [Pyrus x bretschneideri] Length = 335 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYSLT W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSLTTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_009352361.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X2 [Pyrus x bretschneideri] Length = 271 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYSLT W+V+LNLGS G KYADN+VK T Sbjct: 158 GPWWQRLFNGYSLTTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 202 >ref|XP_009352360.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Pyrus x bretschneideri] Length = 335 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYSLT W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSLTTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_008392450.1| PREDICTED: CMP-sialic acid transporter 1 [Malus domestica] Length = 335 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYSLT W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSLTTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_012437742.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X2 [Gossypium raimondii] gi|763782449|gb|KJB49520.1| hypothetical protein B456_008G123700 [Gossypium raimondii] Length = 271 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T W+V+LNLGS G KYADN+VK T Sbjct: 158 GPWWQRLFNGYSITTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 202 >ref|XP_012437741.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Gossypium raimondii] gi|763782448|gb|KJB49519.1| hypothetical protein B456_008G123700 [Gossypium raimondii] Length = 335 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSITTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_011026932.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X3 [Populus euphratica] Length = 298 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 7/42 (16%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKD 18 G W Q LFNGYS+T WMV+LNLGS G KYADN+VKD Sbjct: 222 GSWWQRLFNGYSITTWMVVLNLGSTGLLVSWLMKYADNIVKD 263 >ref|XP_010553552.1| PREDICTED: CMP-sialic acid transporter 1 [Tarenaya hassleriana] Length = 335 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSITTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >gb|KHG29555.1| hypothetical protein F383_05304 [Gossypium arboreum] Length = 335 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGYS+T W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYSITTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266 >ref|XP_010261488.1| PREDICTED: CMP-sialic acid transporter 1 [Nelumbo nucifera] Length = 335 Score = 56.2 bits (134), Expect(2) = 5e-06 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LF+GYS+T WMV+LNLGS+G KYADN+VK T Sbjct: 222 GPWWQRLFDGYSVTTWMVVLNLGSSGLLVSWLMKYADNIVKVYST 266 Score = 20.4 bits (41), Expect(2) = 5e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 204 LYGFGAIFN 178 LY FGAIFN Sbjct: 198 LYTFGAIFN 206 >ref|XP_008239073.1| PREDICTED: CMP-sialic acid transporter 1 [Prunus mume] Length = 335 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 7/45 (15%) Frame = -1 Query: 122 GPWGQCLFNGYSLTRWMVILNLGSAG-------KYADNVVKDLET 9 GPW Q LFNGY+LT W+V+LNLGS G KYADN+VK T Sbjct: 222 GPWWQRLFNGYNLTTWLVVLNLGSTGLLVSWLMKYADNIVKVYST 266