BLASTX nr result
ID: Cinnamomum25_contig00010491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00010491 (201 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010248316.1| PREDICTED: GTP-binding protein At3g49725, ch... 58 1e-06 >ref|XP_010248316.1| PREDICTED: GTP-binding protein At3g49725, chloroplastic [Nelumbo nucifera] Length = 600 Score = 57.8 bits (138), Expect(2) = 1e-06 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 5 SASTSKDVQRVETSAIMGVRLQELLNLIDEKLSTQRSLEKKEL 133 S S +DVQ VETSAIMGV LQELL+LIDEKL TQ++LE+ L Sbjct: 540 SYSQPQDVQHVETSAIMGVGLQELLSLIDEKLKTQKALERSSL 582 Score = 20.8 bits (42), Expect(2) = 1e-06 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 120 KKRSFDHKWRPP 155 ++ S + KWRPP Sbjct: 578 ERSSLNRKWRPP 589