BLASTX nr result
ID: Cinnamomum25_contig00010436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00010436 (230 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlise... 74 5e-11 >gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlisea aurea] Length = 74 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 230 RSVRRKGSVAQSSPSPHGGRGALPSEGGSPSDLLFLAGGG 111 R+VRRKG V ++PSPHGGRGALPSEGGSPSDLLFLAGGG Sbjct: 31 RAVRRKGCVIGTNPSPHGGRGALPSEGGSPSDLLFLAGGG 70