BLASTX nr result
ID: Cinnamomum25_contig00010422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00010422 (1105 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008809995.1| PREDICTED: probable E3 ubiquitin-protein lig... 59 6e-06 ref|XP_002515338.1| ring finger protein, putative [Ricinus commu... 59 6e-06 >ref|XP_008809995.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Phoenix dactylifera] Length = 553 Score = 58.9 bits (141), Expect = 6e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +3 Query: 582 MDEYTEQRGGGGLAISRRGSSLSCRDTSHEDRSIRCSNRLGGSTRLSSMKG 734 MDEY ++ GG S +GS + RD +HEDRSI+ NRLG STRL+S KG Sbjct: 1 MDEYVGKKAAGGRGFSSKGSGIGFRDQNHEDRSIQYCNRLGCSTRLNSTKG 51 >ref|XP_002515338.1| ring finger protein, putative [Ricinus communis] gi|223545282|gb|EEF46787.1| ring finger protein, putative [Ricinus communis] Length = 554 Score = 58.9 bits (141), Expect = 6e-06 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +3 Query: 582 MDEYTEQRGGGGLAISRRGSSLSCRDT-SHEDRSIRCSNRLGGSTRLSSMKGTNTINQEK 758 MDEY+ ++ G GLA+SR+GSS+ RDT ++ DR+ + NR+G S RL+S KGT EK Sbjct: 1 MDEYSGKKAGDGLAVSRKGSSIILRDTANNRDRNAQFCNRIGCSGRLNSAKGTQISCSEK 60 Query: 759 A 761 A Sbjct: 61 A 61