BLASTX nr result
ID: Cinnamomum25_contig00009955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00009955 (429 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009396382.1| PREDICTED: photosystem II 5 kDa protein, chl... 58 2e-06 ref|XP_010906115.1| PREDICTED: photosystem II 5 kDa protein, chl... 57 4e-06 ref|XP_008790532.1| PREDICTED: photosystem II 5 kDa protein, chl... 57 4e-06 ref|XP_007052510.1| Photosystem II 5 kDa protein, chloroplastic ... 57 4e-06 ref|XP_002277909.1| PREDICTED: photosystem II 5 kDa protein, chl... 57 5e-06 gb|KHN45088.1| Photosystem II 5 kDa protein, chloroplastic [Glyc... 56 8e-06 ref|NP_001235677.1| uncharacterized protein LOC100527666 [Glycin... 56 8e-06 >ref|XP_009396382.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 111 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 184 EDPKPGTPEAKKIYAPVCVKMPTARICRK 98 E+PKPGTPEAKK YAP+CV MPTA+ICRK Sbjct: 83 EEPKPGTPEAKKKYAPICVTMPTAKICRK 111 >ref|XP_010906115.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Elaeis guineensis] Length = 113 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 187 GEDPKPGTPEAKKIYAPVCVKMPTARICRK 98 GE+PK GTPEA+K+YAPVCV MPTARIC K Sbjct: 84 GEEPKRGTPEARKLYAPVCVTMPTARICNK 113 >ref|XP_008790532.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Phoenix dactylifera] Length = 113 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 199 TRCHGEDPKPGTPEAKKIYAPVCVKMPTARICRK 98 T GE+PK GTPEA+K+YAP+CV MPTARIC K Sbjct: 80 TAIAGEEPKRGTPEARKLYAPICVTMPTARICHK 113 >ref|XP_007052510.1| Photosystem II 5 kDa protein, chloroplastic [Theobroma cacao] gi|508704771|gb|EOX96667.1| Photosystem II 5 kDa protein, chloroplastic [Theobroma cacao] Length = 106 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 184 EDPKPGTPEAKKIYAPVCVKMPTARICRK 98 ++PKPGTPEA+K+YAP+CV MPTARIC K Sbjct: 78 DEPKPGTPEARKVYAPICVTMPTARICHK 106 >ref|XP_002277909.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic [Vitis vinifera] gi|147792102|emb|CAN66292.1| hypothetical protein VITISV_027031 [Vitis vinifera] Length = 109 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 181 DPKPGTPEAKKIYAPVCVKMPTARICRK 98 +PKPGTPEAKKIYAP+CV MPTA+IC K Sbjct: 82 EPKPGTPEAKKIYAPICVTMPTAKICHK 109 >gb|KHN45088.1| Photosystem II 5 kDa protein, chloroplastic [Glycine soja] Length = 104 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 184 EDPKPGTPEAKKIYAPVCVKMPTARICR 101 ++PKPGTPEAKK YAP+CV MPTARICR Sbjct: 76 DEPKPGTPEAKKKYAPICVTMPTARICR 103 >ref|NP_001235677.1| uncharacterized protein LOC100527666 [Glycine max] gi|255632908|gb|ACU16808.1| unknown [Glycine max] Length = 104 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 184 EDPKPGTPEAKKIYAPVCVKMPTARICR 101 ++PKPGTPEAKK YAP+CV MPTARICR Sbjct: 76 DEPKPGTPEAKKKYAPICVTMPTARICR 103