BLASTX nr result
ID: Cinnamomum25_contig00009650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00009650 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010244283.1| PREDICTED: uncharacterized protein LOC104588... 59 2e-06 ref|XP_009392973.1| PREDICTED: uncharacterized protein LOC103978... 58 2e-06 ref|XP_012067199.1| PREDICTED: uncharacterized protein LOC105630... 56 8e-06 ref|XP_010029817.1| PREDICTED: uncharacterized protein LOC104419... 56 8e-06 ref|XP_002531908.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|XP_010244283.1| PREDICTED: uncharacterized protein LOC104588162 [Nelumbo nucifera] Length = 167 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = -2 Query: 347 PYGLLGAVEGLSYXXXXXXXXXXXXXXLDRGYIPGPVPGDQCFG 216 PYGLLGAVEGLSY LD+G+IPGP+PGDQCFG Sbjct: 124 PYGLLGAVEGLSYLALLGILVVFGLQFLDKGFIPGPLPGDQCFG 167 >ref|XP_009392973.1| PREDICTED: uncharacterized protein LOC103978772 [Musa acuminata subsp. malaccensis] Length = 163 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = -2 Query: 347 PYGLLGAVEGLSYXXXXXXXXXXXXXXLDRGYIPGPVPGDQCFG 216 PYGLLGA EGLSY L+RGYIPGP+PGDQCFG Sbjct: 120 PYGLLGAAEGLSYLAALAVIVVFGLQFLERGYIPGPLPGDQCFG 163 >ref|XP_012067199.1| PREDICTED: uncharacterized protein LOC105630106 [Jatropha curcas] gi|643741026|gb|KDP46588.1| hypothetical protein JCGZ_13708 [Jatropha curcas] Length = 163 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -2 Query: 347 PYGLLGAVEGLSYXXXXXXXXXXXXXXLDRGYIPGPVPGDQCFG 216 P+GLLGAVEGLSY +RGYIPGPV GDQCFG Sbjct: 120 PFGLLGAVEGLSYLSLLAILVVFGLQFSERGYIPGPVTGDQCFG 163 >ref|XP_010029817.1| PREDICTED: uncharacterized protein LOC104419760 [Eucalyptus grandis] gi|629090535|gb|KCW56788.1| hypothetical protein EUGRSUZ_I02457 [Eucalyptus grandis] Length = 167 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -2 Query: 347 PYGLLGAVEGLSYXXXXXXXXXXXXXXLDRGYIPGPVPGDQCFG 216 P+GLLGAVEGLSY D+GYIPGP+P DQCFG Sbjct: 124 PFGLLGAVEGLSYLALLGIAVVFALQFFDKGYIPGPLPADQCFG 167 >ref|XP_002531908.1| conserved hypothetical protein [Ricinus communis] gi|223528448|gb|EEF30481.1| conserved hypothetical protein [Ricinus communis] Length = 163 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 347 PYGLLGAVEGLSYXXXXXXXXXXXXXXLDRGYIPGPVPGDQCFG 216 P+GLLGAVEGLSY LD+GYIPGP+P DQCFG Sbjct: 120 PFGLLGAVEGLSYLSFLAILVVFGLQFLDKGYIPGPLPADQCFG 163