BLASTX nr result
ID: Cinnamomum25_contig00008437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00008437 (566 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510018.1| 50S ribosomal protein CL25, chloroplast prec... 69 1e-09 ref|XP_010936230.1| PREDICTED: 50S ribosomal protein 6, chloropl... 68 3e-09 ref|XP_011652886.1| PREDICTED: 50S ribosomal protein 6, chloropl... 67 4e-09 ref|XP_008790447.1| PREDICTED: uncharacterized protein LOC103707... 67 4e-09 ref|XP_012068126.1| PREDICTED: 50S ribosomal protein 6, chloropl... 67 5e-09 ref|XP_010245611.1| PREDICTED: 50S ribosomal protein 6, chloropl... 67 5e-09 gb|KDP41555.1| hypothetical protein JCGZ_15962 [Jatropha curcas] 67 5e-09 ref|XP_011017030.1| PREDICTED: 50S ribosomal protein 6, chloropl... 66 1e-08 ref|XP_008466097.1| PREDICTED: 50S ribosomal protein 6, chloropl... 66 1e-08 ref|XP_009335472.1| PREDICTED: 50S ribosomal protein 6, chloropl... 65 2e-08 ref|XP_010652377.1| PREDICTED: 50S ribosomal protein 6, chloropl... 65 2e-08 ref|XP_008368119.1| PREDICTED: 50S ribosomal protein 6, chloropl... 65 3e-08 ref|XP_008361594.1| PREDICTED: 50S ribosomal protein 6, chloropl... 65 3e-08 ref|XP_008352748.1| PREDICTED: 50S ribosomal protein 6, chloropl... 65 3e-08 ref|XP_008378687.1| PREDICTED: 50S ribosomal protein 6, chloropl... 65 3e-08 ref|XP_002302374.1| plastid-specific ribosomal family protein [P... 65 3e-08 ref|XP_010104535.1| 50S ribosomal protein 6 [Morus notabilis] gi... 64 3e-08 ref|XP_012445452.1| PREDICTED: 50S ribosomal protein 6, chloropl... 64 3e-08 gb|KJB58735.1| hypothetical protein B456_009G224100 [Gossypium r... 64 3e-08 ref|XP_007137271.1| hypothetical protein PHAVU_009G113500g [Phas... 64 3e-08 >ref|XP_002510018.1| 50S ribosomal protein CL25, chloroplast precursor, putative [Ricinus communis] gi|223550719|gb|EEF52205.1| 50S ribosomal protein CL25, chloroplast precursor, putative [Ricinus communis] Length = 126 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 VIECSSRPKKKATAHH+KTRP+KSQPWDIRRK Sbjct: 44 VIECSSRPKKKATAHHMKTRPKKSQPWDIRRK 75 >ref|XP_010936230.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Elaeis guineensis] Length = 110 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 V+ECSSRPKKKATAHH+KTRP+K+QPWDIRRK Sbjct: 38 VVECSSRPKKKATAHHMKTRPKKTQPWDIRRK 69 >ref|XP_011652886.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Cucumis sativus] gi|700205169|gb|KGN60302.1| hypothetical protein Csa_3G894500 [Cucumis sativus] Length = 106 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 +IECSSRP KKATAHH+KTRPRKSQPWDIRRK Sbjct: 33 LIECSSRPNKKATAHHMKTRPRKSQPWDIRRK 64 >ref|XP_008790447.1| PREDICTED: uncharacterized protein LOC103707655 [Phoenix dactylifera] Length = 158 Score = 67.4 bits (163), Expect = 4e-09 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 V+ECSSRPKKKATAHH+KTRP+K+QPWD+RRK Sbjct: 86 VVECSSRPKKKATAHHMKTRPKKTQPWDVRRK 117 >ref|XP_012068126.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Jatropha curcas] Length = 126 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 +IECSSRPKKKAT+HH+KTRPRKSQPWDI+RK Sbjct: 43 LIECSSRPKKKATSHHMKTRPRKSQPWDIKRK 74 >ref|XP_010245611.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Nelumbo nucifera] Length = 97 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/36 (80%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = -2 Query: 388 GVG-VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 G+G VIECSSRPKKKATAHH+KTRP+K+QPWD+RR+ Sbjct: 30 GMGMVIECSSRPKKKATAHHMKTRPKKTQPWDVRRR 65 >gb|KDP41555.1| hypothetical protein JCGZ_15962 [Jatropha curcas] Length = 122 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 +IECSSRPKKKAT+HH+KTRPRKSQPWDI+RK Sbjct: 43 LIECSSRPKKKATSHHMKTRPRKSQPWDIKRK 74 >ref|XP_011017030.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Populus euphratica] Length = 121 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 376 IECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 IECSSRP+KKATAHH KTRPRKSQPWDIRRK Sbjct: 46 IECSSRPQKKATAHHRKTRPRKSQPWDIRRK 76 >ref|XP_008466097.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Cucumis melo] Length = 106 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 376 IECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 IECSSRP KKATAHH+KTRP+KSQPWDIRRK Sbjct: 34 IECSSRPNKKATAHHMKTRPKKSQPWDIRRK 64 >ref|XP_009335472.1| PREDICTED: 50S ribosomal protein 6, chloroplastic-like [Pyrus x bretschneideri] Length = 119 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 VIECSSRP+KKATAHH KTRPRK+QPWDI+RK Sbjct: 50 VIECSSRPQKKATAHHRKTRPRKTQPWDIKRK 81 >ref|XP_010652377.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Vitis vinifera] Length = 108 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 388 GVGVIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 G VIECSSRP+KK T+HH+KTRPRK+QPWDI+R+ Sbjct: 33 GAAVIECSSRPQKKGTSHHMKTRPRKTQPWDIKRR 67 >ref|XP_008368119.1| PREDICTED: 50S ribosomal protein 6, chloroplastic-like, partial [Malus domestica] Length = 90 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 VIECSSRP+KKATAHH KTRPRK+QPWD++RK Sbjct: 50 VIECSSRPQKKATAHHRKTRPRKTQPWDVKRK 81 >ref|XP_008361594.1| PREDICTED: 50S ribosomal protein 6, chloroplastic-like [Malus domestica] Length = 119 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 VIECSSRP+KKATAHH KTRPRK+QPWD++RK Sbjct: 50 VIECSSRPQKKATAHHRKTRPRKTQPWDVKRK 81 >ref|XP_008352748.1| PREDICTED: 50S ribosomal protein 6, chloroplastic-like [Malus domestica] Length = 119 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 VIECSSRP+KKATAHH KTRPRK+QPWD++RK Sbjct: 50 VIECSSRPQKKATAHHRKTRPRKTQPWDVKRK 81 >ref|XP_008378687.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Malus domestica] Length = 119 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 379 VIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 VIECSSRP+KKATAHH KTRPRK+QPWD++RK Sbjct: 50 VIECSSRPQKKATAHHRKTRPRKTQPWDVKRK 81 >ref|XP_002302374.1| plastid-specific ribosomal family protein [Populus trichocarpa] gi|118486925|gb|ABK95296.1| unknown [Populus trichocarpa] gi|222844100|gb|EEE81647.1| plastid-specific ribosomal family protein [Populus trichocarpa] Length = 123 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 376 IECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 IECSSRP+KKATAHH KTRPRKSQPWDI+RK Sbjct: 46 IECSSRPQKKATAHHRKTRPRKSQPWDIKRK 76 >ref|XP_010104535.1| 50S ribosomal protein 6 [Morus notabilis] gi|587913319|gb|EXC01136.1| 50S ribosomal protein 6 [Morus notabilis] Length = 115 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 388 GVGVIECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 G VIECSSRP KKATAHH+KTRP+K+Q WDIRRK Sbjct: 39 GPAVIECSSRPTKKATAHHMKTRPKKTQAWDIRRK 73 >ref|XP_012445452.1| PREDICTED: 50S ribosomal protein 6, chloroplastic [Gossypium raimondii] Length = 118 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 376 IECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 IECSSRP+KKAT HH+KTRPRK+QPWDIRRK Sbjct: 43 IECSSRPQKKATKHHMKTRPRKTQPWDIRRK 73 >gb|KJB58735.1| hypothetical protein B456_009G224100 [Gossypium raimondii] Length = 119 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 376 IECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 IECSSRP+KKAT HH+KTRPRK+QPWDIRRK Sbjct: 43 IECSSRPQKKATKHHMKTRPRKTQPWDIRRK 73 >ref|XP_007137271.1| hypothetical protein PHAVU_009G113500g [Phaseolus vulgaris] gi|561010358|gb|ESW09265.1| hypothetical protein PHAVU_009G113500g [Phaseolus vulgaris] Length = 96 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 376 IECSSRPKKKATAHHIKTRPRKSQPWDIRRK 284 I CSSRPKKKATAHH+KTRPRKSQPWDI RK Sbjct: 32 IVCSSRPKKKATAHHMKTRPRKSQPWDINRK 62