BLASTX nr result
ID: Cinnamomum25_contig00008284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00008284 (519 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010268820.1| PREDICTED: uroporphyrinogen-III synthase, ch... 61 3e-07 >ref|XP_010268820.1| PREDICTED: uroporphyrinogen-III synthase, chloroplastic [Nelumbo nucifera] Length = 294 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -2 Query: 518 RLGLKNVYHSEYPGLEGWVDSILDALKLNDQVHEALVS 405 +LGLKNVYH PGLEGWVDSIL+AL+++DQ+ +AL+S Sbjct: 257 KLGLKNVYHPTNPGLEGWVDSILEALRVHDQIRKALIS 294