BLASTX nr result
ID: Cinnamomum25_contig00007353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00007353 (377 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010108544.1| Signal recognition particle receptor subunit... 74 5e-11 ref|XP_012450759.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_012443365.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_011097530.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_011083961.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_010910254.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_010908801.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_010680162.1| PREDICTED: signal recognition particle recep... 74 5e-11 gb|KHG29410.1| Signal recognition particle receptor subunit alph... 74 5e-11 gb|KHG14580.1| Signal recognition particle receptor subunit alph... 74 5e-11 ref|XP_010265561.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009798541.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009790358.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009594909.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009614623.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009366190.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009358431.1| PREDICTED: signal recognition particle recep... 74 5e-11 ref|XP_009137943.1| PREDICTED: signal recognition particle recep... 74 5e-11 emb|CDX68673.1| BnaC01g07800D [Brassica napus] 74 5e-11 emb|CDX72255.1| BnaC07g42770D [Brassica napus] 74 5e-11 >ref|XP_010108544.1| Signal recognition particle receptor subunit alpha-like protein [Morus notabilis] gi|587932631|gb|EXC19666.1| Signal recognition particle receptor subunit alpha-like protein [Morus notabilis] Length = 740 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 694 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 730 >ref|XP_012450759.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Gossypium raimondii] gi|823236229|ref|XP_012450760.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Gossypium raimondii] gi|763798847|gb|KJB65802.1| hypothetical protein B456_010G113600 [Gossypium raimondii] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >ref|XP_012443365.1| PREDICTED: signal recognition particle receptor subunit alpha-like isoform X1 [Gossypium raimondii] gi|823120891|ref|XP_012443443.1| PREDICTED: signal recognition particle receptor subunit alpha-like isoform X1 [Gossypium raimondii] gi|823120893|ref|XP_012443524.1| PREDICTED: signal recognition particle receptor subunit alpha-like isoform X1 [Gossypium raimondii] gi|763740099|gb|KJB07598.1| hypothetical protein B456_001G032400 [Gossypium raimondii] gi|763740100|gb|KJB07599.1| hypothetical protein B456_001G032400 [Gossypium raimondii] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >ref|XP_011097530.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Sesamum indicum] gi|747098989|ref|XP_011097531.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Sesamum indicum] Length = 625 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 579 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 615 >ref|XP_011083961.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Sesamum indicum] Length = 626 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 580 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 616 >ref|XP_010910254.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Elaeis guineensis] gi|743886892|ref|XP_010910255.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Elaeis guineensis] Length = 628 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 582 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 618 >ref|XP_010908801.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Elaeis guineensis] gi|743881053|ref|XP_010908802.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Elaeis guineensis] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >ref|XP_010680162.1| PREDICTED: signal recognition particle receptor subunit alpha [Beta vulgaris subsp. vulgaris] gi|870857573|gb|KMT09121.1| hypothetical protein BVRB_6g132280 [Beta vulgaris subsp. vulgaris] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >gb|KHG29410.1| Signal recognition particle receptor subunit alpha [Gossypium arboreum] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >gb|KHG14580.1| Signal recognition particle receptor subunit alpha [Gossypium arboreum] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >ref|XP_010265561.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Nelumbo nucifera] gi|720030594|ref|XP_010265562.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Nelumbo nucifera] Length = 622 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 576 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 612 >ref|XP_009798541.1| PREDICTED: signal recognition particle receptor subunit alpha [Nicotiana sylvestris] Length = 627 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 581 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 617 >ref|XP_009790358.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Nicotiana sylvestris] Length = 240 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 194 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 230 >ref|XP_009594909.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Nicotiana tomentosiformis] Length = 618 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 572 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 608 >ref|XP_009614623.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Nicotiana tomentosiformis] Length = 627 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 581 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 617 >ref|XP_009366190.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Pyrus x bretschneideri] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >ref|XP_009358431.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Pyrus x bretschneideri] Length = 621 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 575 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 611 >ref|XP_009137943.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Brassica rapa] Length = 614 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 568 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 604 >emb|CDX68673.1| BnaC01g07800D [Brassica napus] Length = 628 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 582 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 618 >emb|CDX72255.1| BnaC07g42770D [Brassica napus] Length = 616 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 376 DTIDDKVRAALSMVYISGAPVMFVGCGQSYTDLKRLN 266 DTIDDKV AALSMVYISGAPVMFVGCGQSYTDLK+LN Sbjct: 570 DTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLN 606