BLASTX nr result
ID: Cinnamomum25_contig00007018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00007018 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010929840.1| PREDICTED: protein PRD1 [Elaeis guineensis] 59 2e-06 ref|XP_008775314.1| PREDICTED: LOW QUALITY PROTEIN: protein PRD1... 59 2e-06 >ref|XP_010929840.1| PREDICTED: protein PRD1 [Elaeis guineensis] Length = 1322 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 258 WENLAVKEKRAIEGDRWFRLPMEELPMSLSAPGLASKSFTN 136 WE ++EKRAI+ +W RL MEEL M+L+APGLAS+SFTN Sbjct: 1136 WEKFGLQEKRAIKDSKWCRLVMEELAMTLAAPGLASRSFTN 1176 >ref|XP_008775314.1| PREDICTED: LOW QUALITY PROTEIN: protein PRD1 [Phoenix dactylifera] Length = 672 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 258 WENLAVKEKRAIEGDRWFRLPMEELPMSLSAPGLASKSFTN 136 WE ++EKRAI+ +W RL MEEL MSL+APGLAS SFTN Sbjct: 486 WEKFGLQEKRAIKDSKWCRLVMEELAMSLAAPGLASTSFTN 526