BLASTX nr result
ID: Cinnamomum25_contig00006735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00006735 (338 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK30592.1| hypothetical protein AALP_AA6G001700 [Arabis alpina] 57 4e-06 ref|XP_012437503.1| PREDICTED: scarecrow-like protein 6 [Gossypi... 56 8e-06 >gb|KFK30592.1| hypothetical protein AALP_AA6G001700 [Arabis alpina] Length = 587 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 3 RVPLREFHVVKRHASLMLCWQGRELVATSAWRC 101 R P+R FHV K+H SL+LCWQ RELVA SAWRC Sbjct: 553 RTPVRGFHVEKKHNSLLLCWQRRELVAVSAWRC 585 >ref|XP_012437503.1| PREDICTED: scarecrow-like protein 6 [Gossypium raimondii] gi|763782127|gb|KJB49198.1| hypothetical protein B456_008G106000 [Gossypium raimondii] Length = 698 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 RVPLREFHVVKRHASLMLCWQGRELVATSAWRC 101 R P+R FHV KR +SL+LCWQ REL+A SAWRC Sbjct: 666 RTPIRGFHVEKRQSSLVLCWQRRELIAASAWRC 698