BLASTX nr result
ID: Cinnamomum25_contig00006561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00006561 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633116.1| PREDICTED: programmed cell death protein 4-l... 69 2e-09 >ref|XP_003633116.1| PREDICTED: programmed cell death protein 4-like [Vitis vinifera] Length = 78 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/60 (58%), Positives = 40/60 (66%) Frame = -2 Query: 182 PRKAQRSHTRVIQVERNDRKNTTGMKSLSPKKGGHGGKFTWSGNNRNSLVETEFKKGAVD 3 P K + H + Q R DRK+ TGM SPKKGGHGGKFTWSG+ NS E EF+ GAVD Sbjct: 4 PGKGSKCHAKSGQEVRKDRKSATGMSG-SPKKGGHGGKFTWSGDG-NSRTEIEFRNGAVD 61