BLASTX nr result
ID: Cinnamomum25_contig00006168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00006168 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010936796.1| PREDICTED: LOW QUALITY PROTEIN: putative nuc... 61 3e-07 ref|XP_008782406.1| PREDICTED: putative nuclear matrix constitue... 60 4e-07 ref|XP_004297151.1| PREDICTED: putative nuclear matrix constitue... 59 2e-06 >ref|XP_010936796.1| PREDICTED: LOW QUALITY PROTEIN: putative nuclear matrix constituent protein 1-like protein [Elaeis guineensis] Length = 1256 Score = 60.8 bits (146), Expect = 3e-07 Identities = 34/67 (50%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = -1 Query: 222 PPKRKYSRRKPVKKSRLKSTP---SVKQVIEDAKVFLGETSEPNKDGQPNAAARDPAQTN 52 P K RR P +K R K+T SVK V+EDAK LGETSE DG PN RD Sbjct: 966 PEPLKQRRRLPNRKGRPKATRRTRSVKAVVEDAKAILGETSEEKNDGPPNGVTRDSLNIQ 1025 Query: 51 QGSQGDS 31 + SQGDS Sbjct: 1026 EESQGDS 1032 >ref|XP_008782406.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein [Phoenix dactylifera] Length = 1132 Score = 60.5 bits (145), Expect = 4e-07 Identities = 34/73 (46%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Frame = -1 Query: 222 PPKRKYSRRKPVKKSRLKS---TPSVKQVIEDAKVFLGETSEPNKDGQPNAAARDPAQTN 52 P K RR P +K R K+ T SVK V+EDAK LGETSE DG PN +D Sbjct: 966 PEPSKQRRRLPGRKGRPKAIRRTRSVKAVVEDAKAILGETSEEKNDGPPNGVTKDSLNIQ 1025 Query: 51 QGSQGDSHTTNIG 13 + SQGDS + G Sbjct: 1026 EESQGDSVHADTG 1038 >ref|XP_004297151.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein [Fragaria vesca subsp. vesca] Length = 1148 Score = 58.5 bits (140), Expect = 2e-06 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = -1 Query: 210 KYSRRKPVK--KSRLKSTPSVKQVIEDAKVFLGETSEPNKDGQPNAAARDPAQTNQGSQG 37 K RRKP + KSRL T SVK V+EDAK FLGET EP+ N +++ ++G Sbjct: 907 KSGRRKPARGRKSRLSRTHSVKAVVEDAKKFLGETPEPSNASLLN-------ESSYINEG 959 Query: 36 DSHTTNIGKKRP 1 DS T+IG+KRP Sbjct: 960 DSSFTSIGRKRP 971