BLASTX nr result
ID: Cinnamomum25_contig00005921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00005921 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010260616.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_010260616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Nelumbo nucifera] Length = 466 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 285 KPNFPVYMRVMKDLFKLGKGDLVADLKAKFAKFHSNTGNG 166 +PNFPVYM+VMK L+KLGKG LVADLK +F+KF+S+ G Sbjct: 427 RPNFPVYMKVMKSLYKLGKGYLVADLKDRFSKFNSSKEAG 466