BLASTX nr result
ID: Cinnamomum25_contig00005731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00005731 (220 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001869361.1| conserved hypothetical protein [Culex quinqu... 59 1e-06 >ref|XP_001869361.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167865696|gb|EDS29079.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 212 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 ATTTKICANGSSMSAHARHFNAYHSTFLLTGVSK 104 ATTTKICA+G SMSA+ARHFNA+H T LL GVSK Sbjct: 37 ATTTKICASGGSMSAYARHFNAHHQTLLLAGVSK 70