BLASTX nr result
ID: Cinnamomum25_contig00005711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00005711 (318 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011039348.1| PREDICTED: two-component response regulator-... 57 6e-06 ref|XP_011039330.1| PREDICTED: two-component response regulator-... 57 6e-06 ref|XP_002320232.2| hypothetical protein POPTR_0014s10160g [Popu... 57 6e-06 ref|XP_010658154.1| PREDICTED: two-component response regulator-... 56 8e-06 ref|XP_010658157.1| PREDICTED: two-component response regulator-... 56 8e-06 >ref|XP_011039348.1| PREDICTED: two-component response regulator-like APRR9 isoform X2 [Populus euphratica] Length = 676 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 316 KKVRYQSRKKLAEERPRVKGQFVRRVQHDS 227 KKVRYQSRK+LAE+RPRVKGQFVR+VQ+DS Sbjct: 644 KKVRYQSRKRLAEQRPRVKGQFVRQVQNDS 673 >ref|XP_011039330.1| PREDICTED: two-component response regulator-like APRR5 isoform X1 [Populus euphratica] Length = 695 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 316 KKVRYQSRKKLAEERPRVKGQFVRRVQHDS 227 KKVRYQSRK+LAE+RPRVKGQFVR+VQ+DS Sbjct: 663 KKVRYQSRKRLAEQRPRVKGQFVRQVQNDS 692 >ref|XP_002320232.2| hypothetical protein POPTR_0014s10160g [Populus trichocarpa] gi|550323887|gb|EEE98547.2| hypothetical protein POPTR_0014s10160g [Populus trichocarpa] gi|657292059|gb|AID51413.1| pseudo-response regulator 9b [Populus trichocarpa] Length = 717 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 316 KKVRYQSRKKLAEERPRVKGQFVRRVQHDS 227 KKVRYQSRK+LAE+RPRVKGQFVR+VQ+DS Sbjct: 683 KKVRYQSRKRLAEQRPRVKGQFVRQVQNDS 712 >ref|XP_010658154.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] gi|731411847|ref|XP_010658155.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] gi|731411849|ref|XP_010658156.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] Length = 770 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 316 KKVRYQSRKKLAEERPRVKGQFVRRVQHDSHQPSAE 209 KKVRYQSRK+LAE+RPR++GQFVRRV HD + A+ Sbjct: 734 KKVRYQSRKRLAEQRPRIRGQFVRRVFHDINSEDAD 769 >ref|XP_010658157.1| PREDICTED: two-component response regulator-like PRR37 isoform X2 [Vitis vinifera] gi|297736458|emb|CBI25329.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 316 KKVRYQSRKKLAEERPRVKGQFVRRVQHDSHQPSAE 209 KKVRYQSRK+LAE+RPR++GQFVRRV HD + A+ Sbjct: 733 KKVRYQSRKRLAEQRPRIRGQFVRRVFHDINSEDAD 768