BLASTX nr result
ID: Cinnamomum25_contig00004461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00004461 (380 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011654821.1| PREDICTED: 60S ribosomal protein L15-2 [Cucu... 81 3e-13 ref|XP_012466674.1| PREDICTED: 60S ribosomal protein L15-1-like ... 81 3e-13 ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like ... 81 3e-13 ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isofo... 81 3e-13 ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isofo... 81 3e-13 ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like ... 81 3e-13 ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus com... 81 3e-13 ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [C... 81 3e-13 ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citr... 81 3e-13 ref|XP_006838929.1| PREDICTED: 60S ribosomal protein L15-1 [Ambo... 81 3e-13 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus] 81 3e-13 ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-1 [Cucu... 81 3e-13 emb|CBI38664.3| unnamed protein product [Vitis vinifera] 81 3e-13 emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] 81 3e-13 ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis] ... 79 1e-12 ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis] ... 79 1e-12 ref|XP_012489073.1| PREDICTED: 60S ribosomal protein L15 [Gossyp... 79 1e-12 ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [N... 79 1e-12 ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [S... 79 2e-12 ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [S... 79 2e-12 >ref|XP_011654821.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis sativus] Length = 226 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 184 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 219 >ref|XP_012466674.1| PREDICTED: 60S ribosomal protein L15-1-like [Gossypium raimondii] gi|728843354|gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum] gi|763740372|gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo] gi|659102595|ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo] gi|659102597|ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo] gi|659107884|ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo] Length = 214 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 172 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 207 >ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis] gi|223550092|gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis] gi|641842486|gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina] gi|557542540|gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina] Length = 230 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 188 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 223 >ref|XP_006838929.1| PREDICTED: 60S ribosomal protein L15-1 [Amborella trichopoda] gi|548841435|gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-1 [Cucumis sativus] gi|778676428|ref|XP_011650580.1| PREDICTED: 60S ribosomal protein L15-1 [Cucumis sativus] gi|778676431|ref|XP_011650582.1| PREDICTED: 60S ribosomal protein L15-1 [Cucumis sativus] gi|700197992|gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus] gi|700201150|gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus] gi|700201151|gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >emb|CBI38664.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 144 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 179 >emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] Length = 204 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis] gi|587926694|gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis] Length = 204 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGH HHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNNT 197 >ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis] gi|587914339|gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis] Length = 241 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGH HHKARPSRRATWKRNNT Sbjct: 199 RGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNNT 234 >ref|XP_012489073.1| PREDICTED: 60S ribosomal protein L15 [Gossypium raimondii] gi|728812558|gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum] gi|763772970|gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii] Length = 204 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRA WKRNNT Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRANWKRNNT 197 >ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera] Length = 204 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGL GKGHLHHKARPSRRATWKRNNT Sbjct: 162 RGLTSAGKKYRGLHGKGHLHHKARPSRRATWKRNNT 197 >ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] Length = 204 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN T Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] gi|747059967|ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] Length = 204 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 378 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 271 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN T Sbjct: 162 RGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197