BLASTX nr result
ID: Cinnamomum25_contig00003925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00003925 (460 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN05055.1| hypothetical protein AMTR_s00053p00096150 [Ambore... 57 4e-06 >gb|ERN05055.1| hypothetical protein AMTR_s00053p00096150 [Amborella trichopoda] Length = 51 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = -2 Query: 432 MPKSETQGRERKEQLPPGYPNENHPPAKKKCCPPRSTKKGEKGFIEG 292 MPK E Q +ERK+Q PPGYP + P K KC P KKG++GFIEG Sbjct: 1 MPKFENQVKERKQQPPPGYPQGSPPQVKSKC--PHVRKKGDRGFIEG 45